(data stored in ACNUC30630 zone)

EMBL: CP001515.PE343

CP001515.PE343       Location/Qualifiers
FT   CDS_pept        complement(441021..441578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45741"
FT                   /protein_id="ACS45741.1"
FT                   /translation="MLLALSVGVALFCTLQCVALATATRQAVVAARDLDAGLVIATGDV
FT                   EMVEMPDHDALRHALGCPDDAVGLVTQTRIEKGDILLTTDVGELPQVPEHHTVIDVRLG
FT                   LGQHSFPIGTVVELRSTQACADDARASPEGCVVSSHAVVMAQPRLDDTGSTVTQMAMSA
FT                   VEALQVLAAQEHGTLIAARGAS"
     atgctgctgg cgctgtctgt aggcgtggcg ttgttctgca cactgcaatg cgtggcactg        60
     gcgacggcca cacggcaggc cgtggtcgcc gcgcgcgatc tcgatgccgg tctggtgatt       120
     gcaaccggcg atgtggagat ggtggagatg cccgaccatg acgccctgcg ccatgcactg       180
     gggtgcccgg acgacgcagt ggggctggtc acgcagaccc gcatcgagaa gggcgatatt       240
     ctactgacca ccgatgtcgg tgagcttccc caagttcccg agcaccatac cgtgatcgat       300
     gtgcgacttg gactcgggca gcattccttc cctattggca ccgtggtgga actgcgttcg       360
     acacaggcat gcgccgacga tgcccgcgcc tcgccagaag ggtgcgtagt gagcagtcac       420
     gcggtggtaa tggcacaacc gagactcgac gacaccggct cgacagtgac gcagatggcg       480
     atgagcgccg tggaggcgtt gcaggtgctt gccgcacagg agcatggcac attgattgcg       540
     gcacgaggtg cgtcatga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page