(data stored in ACNUC30630 zone)

EMBL: CP001515.PE351

CP001515.PE351       Location/Qualifiers
FT   CDS_pept        448005..449507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0365"
FT                   /product="Amino acid transporter"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45749"
FT                   /protein_id="ACS45749.1"
FT                   /translation="MGVAVAVGAGIFSVGAQAAAFHAGPAVIISFIIAGIVCGAAVMCY
FT                   AEFASVMPVAGSAYTFTYATLGEIFAWIIGWDLILEMLMAGSVISKFWGVYLNDFLRLM
FT                   GVNFNTNIMIGSFHLDIAPIVIVAFFTTLLVLGTKIGARVDGAMTVLKIAVVLFVVIVG
FT                   FFYVKASNYTPFIPPAEPSADVANATTVHGTLGQPLFQWLTHMSPTIYGVPGIISGAAL
FT                   VFFAFIGFDVVATASEETRNPKRNVPLGIGVGMSLIIVMYVLVAIVTTGMVSYKQLASV
FT                   ESPSLATAFELVGADWAAKIISFGICLGLATVVMVLLLGLTRVVFAMSRDGLLPRTLST
FT                   TGKHGTPARLQIVVGVVVAIIAACFNIDVLSDMVNIGTLSAFTLVALAIPIMRKRRPDL
FT                   KRSFRMPGNPWVPLLVALANFYLMLNLTVLTWIRFLIWLVVGFIIYFAYGYNHARVGTG
FT                   ELDAEVVKYEKQRQLKAQRAKQSGSVGRGNDAAVTKVEAGKD"
     atgggcgtgg ccgtcgccgt gggcgcgggc atcttctcgg tgggtgcgca ggctgcggca        60
     ttccacgcgg ggccggcggt tatcatcagt ttcatcatcg ccggcatcgt gtgcggggcg       120
     gcggtcatgt gctatgcgga gttcgcgtcg gtgatgccgg tggcgggttc ggcgtacacg       180
     ttcacgtatg ccacgcttgg tgagattttc gcgtggatca tcggctggga cctgattctc       240
     gagatgctca tggccggttc ggtcatctcc aagttctggg gcgtgtatct caacgatttt       300
     ctgcgtctca tgggcgtcaa cttcaacacg aacatcatga tcggctcgtt ccatctcgac       360
     atcgcgccca tcgtgatcgt cgcgttcttc accacgctgc tggtgctcgg cacgaagatc       420
     ggcgcacgcg tggacggcgc gatgaccgtg ctcaagatag ccgtcgtgct gttcgtcgtc       480
     atcgtcggct tcttctatgt gaaggcctcc aactacacgc cgttcatccc gccggcagaa       540
     ccctcggcgg acgtggcgaa tgcgaccacg gtgcacggga ccctgggcca accgctgttc       600
     cagtggctta cgcatatgag cccgaccatc tacggtgttc caggcatcat ctcgggtgct       660
     gcactcgtgt tcttcgcctt catcggcttt gacgtcgtcg ccactgcatc cgaggagacc       720
     cgtaatccga agcgtaacgt gccgctcggc atcggcgtgg gcatgtcgct catcatcgtc       780
     atgtacgtgc tcgtcgccat cgtgaccacc ggcatggtct cctacaagca gctcgcctcc       840
     gtcgagagcc cgtcgctggc cactgcattc gagttggtgg gggcggactg ggccgccaag       900
     atcatcagct tcggcatctg ccttggcttg gccaccgtgg tcatggtgct gctgttggga       960
     ctcacgcgcg tcgtgttcgc catgagccgt gacggtttgc ttccgcgtac cctttcgacc      1020
     accggcaagc acggcactcc ggcacgtctg cagattgtcg tcggcgtggt cgtcgccatc      1080
     atcgccgcgt gcttcaacat tgacgtgctg agcgacatgg tgaatatcgg cacgctttcc      1140
     gcgttcacgc tggtggccct cgccatcccg atcatgcgca agcgcaggcc cgatctgaaa      1200
     cgcagcttca gaatgccggg caatccgtgg gttccgctgc tcgtcgcgct tgcgaacttc      1260
     tacctcatgc tgaacctcac cgtgctcact tggattcgct tcctcatatg gctcgtggtt      1320
     ggcttcatca tctactttgc ctacgggtac aaccatgcgc gcgtgggcac cggtgaactt      1380
     gacgccgagg tggtcaaata cgagaagcag cgccagctca aggcgcagcg cgcgaaacag      1440
     tccggttccg tcggccgggg gaatgacgcg gccgtgacca aggtcgaagc cggcaaagac      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page