(data stored in ACNUC30630 zone)

EMBL: CP001515.PE356

CP001515.PE356       Location/Qualifiers
FT   CDS_pept        454286..454921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0371"
FT                   /product="hypothetical protein"
FT                   /note="COG1739 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45754"
FT                   /protein_id="ACS45754.1"
FT                   /translation="MRTLLNPADEPAHDAFVEKKSEFIGDACHVDSLEDALAFVETVRE
FT                   RHPKARHVAYAAIVTGDDGRVMERMSDDGEPSGTAGKPILDVLRANELTDCVIAVTRYF
FT                   GGILLGSGGLIRAYSTGASIAVKAADVAQIVVCARYAVPLDYSQLGPMRHLVEVMGAVE
FT                   ESADFSDHVVLIVLVRDDARESFEHRVREQFSATVTPEYVGRCHRAMR"
     atgcgtacct tgttgaatcc ggccgacgag ccggcgcacg atgcattcgt ggagaagaag        60
     tccgagttca taggcgacgc ctgccatgtc gattcgcttg aggatgcgct cgcgttcgtc       120
     gagaccgtgc gcgagcgtca cccgaaagca cgacatgtgg cctatgcggc gattgtgacc       180
     ggtgacgatg gccgtgtgat ggagcgcatg agcgatgatg gcgagccgag cggcacggcg       240
     ggcaagccga tcctcgatgt gttgcgtgcg aatgaactca cagattgcgt gattgccgtc       300
     acgcgatatt tcggcggcat tctgctcggt tcgggcggtc tcatccgcgc atactccacc       360
     ggagcgtcga ttgcggtgaa ggcagcggat gtcgcacaga ttgtggtctg tgcccggtat       420
     gcggtgccgc tcgactactc gcagctcggg ccgatgcgcc atctggtcga ggtgatgggc       480
     gcggtggagg agtctgccga tttctcggat cacgtggtgc tcatcgtgct cgtgcgcgat       540
     gatgcgcgcg aatcgttcga acatcgtgtg cgcgagcagt tcagtgcgac ggtgacgccg       600
     gagtatgtgg gccgatgcca ccgcgcgatg cggtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page