(data stored in ACNUC30630 zone)

EMBL: CP001515.PE378

CP001515.PE378       Location/Qualifiers
FT   CDS_pept        474580..474915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0393"
FT                   /product="Ribosomal protein L24"
FT                   /note="COG0198 Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45776"
FT                   /protein_id="ACS45776.1"
FT                   /translation="MVAKIKSGDLVKVIRGKDRGKEGTVKRVLKDDRLIVEGVQIVKKH
FT                   VRATQQGQQAGIVSVEAPIHRSNVMVIDPETKQPTRVGVVIKEEARDGKVKTVRVRVAK
FT                   KSGKELA"
     atggtagcca agatcaagag cggcgacctc gtcaaggtca tccgtggcaa ggaccgcggc        60
     aaggaaggca ccgtcaagcg cgttctcaag gatgaccgac tgattgtcga aggcgttcag       120
     atcgtcaaga agcatgtgcg tgcaacccag cagggtcagc aggccggcat cgtctccgtt       180
     gaggccccga tccatcgctc caacgtgatg gtcatcgacc cggagaccaa gcagcccacc       240
     cgcgttggcg tcgtaatcaa ggaagaggca cgtgacggca aggtgaagac cgtgcgcgtc       300
     cgcgttgcca agaagtccgg aaaggaactg gcatga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page