(data stored in ACNUC30630 zone)

EMBL: CP001515.PE41

CP001515.PE41        Location/Qualifiers
FT   CDS_pept        complement(45029..45178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45439"
FT                   /protein_id="ACS45439.1"
FT                   /translation="MFASCNAHNAHEEPNTESMQAIAEGDAFLASGQEGRFSNAESLIK
FT                   AALN"
     atgttcgcca gctgcaacgc gcacaatgcc cacgaggaac cgaataccga aagcatgcag        60
     gccattgcag aaggagacgc cttccttgcc agcggtcaag aggggcgctt cagcaacgcc       120
     gaatcgctga tcaaggcagc ccttaactga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page