(data stored in ACNUC30630 zone)

EMBL: CP001515.PE414

CP001515.PE414       Location/Qualifiers
FT   CDS_pept        510963..513050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0431"
FT                   /product="hypothetical protein"
FT                   /note="COG1983 Putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45812"
FT                   /protein_id="ACS45812.1"
FT                   /translation="MGNANHNPQQPQGETLGNGQSAGQYGQPGQGQYSHTSYNANTTYN
FT                   TDYENGRPTPNANNGGERPESSFFRWIRESGVQRTNNRVIAGVCGAIAQELGWNVTLVR
FT                   VLMVVLAFMGGTGVFFYGLAWALLPDESDGSILLEDLIHGHWNWSFIGVILCILLSGVL
FT                   VVPFFGFHGAVNVMPILLSALAMYLVIDHGRRRFMRPNSMNGGIGGNGGNTGGYGGPAP
FT                   APPMPPMPNVGERAAGPSMPAQQPGAYPNAARYGMPAAAPQNSGYTQYAQPAQPFRGER
FT                   PNVTQPESQSPAQQSADAGTPTVNMPPVAAGSASAQAFRPAQPQSASQSAYHYTYHYEP
FT                   KDYTYEYRGATKARRKPAGPAVVLLFLGLLIAGMAVVSLICGSAGNGSFSTLFGASRGA
FT                   VLFIGGACLVLGLIIVALGCAGRRTGGLHPFAWTLMFLAVIAMCFGGAVGAANSLSPYL
FT                   AKDYKHVNVGKTLVIDSSKASMETLRKGIAVQGEGYAKSTLTIDLTKYTGHNKAKQVRL
FT                   NDGQTRTTYCPVETIPMTVTDAKVMVKIPYGCSWGFNVSSGMMSTWNSIDAQGGLLATG
FT                   VCSEGDRGNGWDIQAGRSGFQISGAHPDGNGISSWYSMTGDMNELCENVGVDDDMNHAV
FT                   TKNTDPRVKQLAENGYYWPCLTDNAKSVAHTELNISPRLLRNASVTVSYGGDIADAAKK
FT                   H"
     atgggcaacg caaaccacaa tccacagcag ccgcagggcg agaccctcgg caacggccag        60
     tccgccggcc agtacggtca gcctgggcaa ggccagtatt ctcacacctc ctacaatgcc       120
     aacaccacct acaacaccga ctatgagaac gggcgtccca cgccgaacgc caacaacggc       180
     ggcgaacgcc ctgaatcctc gttcttccgc tggattcgcg aaagcggcgt gcagcgtacg       240
     aacaatcgcg tgatcgcagg tgtgtgcggc gccatcgcgc aggagctcgg ctggaacgtc       300
     acgctcgtgc gcgtgctcat ggtcgtgttg gcattcatgg gcggcaccgg cgtgttcttc       360
     tacggactcg cctgggcgct gctgcccgat gaatccgacg ggtcgatcct gctcgaagac       420
     ctcatccatg ggcactggaa ctggtcgttc atcggcgtga tcctatgcat cctgctttcg       480
     ggcgtgttgg tcgtgccgtt ctttggattc cacggtgccg tgaacgtgat gccgattctg       540
     ctttccgcac tggccatgta cctcgtcatc gaccacgggc gccgccggtt catgcggccg       600
     aactccatga atggcggcat cggtgggaac ggcggcaaca cgggtggcta tggaggcccg       660
     gcaccggctc ctcccatgcc gccgatgccc aatgtgggcg agcgcgccgc cggcccctcc       720
     atgccggcgc agcagccggg cgcctatccg aatgccgcac ggtatggcat gccggcggcc       780
     gccccgcaga acagcggata cacgcaatat gcgcagcccg cgcagccctt tcgtggggaa       840
     cgtccgaatg tgacccagcc agagtcgcag tcgccggcgc agcagtccgc tgacgcaggt       900
     actccaaccg tcaatatgcc accagtcgcc gctggcagtg catcggcgca agcgttccgg       960
     ccagcgcaac cgcagtccgc aagccagagc gcatatcact atacctacca ctacgagccc      1020
     aaggactaca cctatgaata ccggggcgca acgaaggcac gccgtaagcc tgcagggccg      1080
     gcggtggtgc tgctgttcct cgggctcctc attgcgggta tggcggtggt gtccctgatc      1140
     tgcggttccg ccggcaacgg ctcgttcagc acattgtttg gggcgtcccg cggcgcggtg      1200
     ctgttcatcg gcggcgcatg ccttgtgctc ggtctcatca tcgtcgcctt ggggtgtgcc      1260
     ggcaggcgca ccggtggcct gcaccccttc gcatggacgc tcatgttcct cgccgtgatc      1320
     gccatgtgct tcggcggtgc ggtgggggcc gcgaactcgc tgagccctta cttggccaag      1380
     gattacaagc acgtcaacgt gggcaagacg ctggtgatcg actcgtcgaa ggcgagcatg      1440
     gagacattgc gcaagggcat cgccgtgcag ggcgaaggct acgcgaaatc cacgctcacc      1500
     atcgacctga cgaagtatac cgggcacaac aaggcgaagc aggttcgtct caacgacggg      1560
     cagaccagga ccacgtactg cccagtcgag acgattccga tgacggtcac cgatgccaag      1620
     gtgatggtca agattcccta cgggtgttca tggggtttca acgtatcgtc gggcatgatg      1680
     agcacgtgga attcgattga cgcccagggg ggcctgctgg ccaccggtgt gtgcagcgaa      1740
     ggcgatcgag gcaacggctg ggacattcag gccggccgct cgggcttcca aatctccggt      1800
     gcccaccccg acggcaacgg catcagctcg tggtacagca tgactggcga catgaacgag      1860
     ttgtgcgaga acgtcggggt tgacgacgac atgaaccacg ccgtcacgaa gaacaccgac      1920
     ccgcgcgtca agcagctcgc cgagaacggc tattactggc cgtgcctcac cgacaatgcg      1980
     aaaagcgtgg cgcacaccga actcaacatc tcaccccgcc tgctgcgcaa cgcctcggtg      2040
     acggtctcct acggcggcga tatcgccgac gccgcgaaga aacactga                   2088
//

If you have problems or comments...

PBIL Back to PBIL home page