(data stored in ACNUC30630 zone)

EMBL: CP001515.PE426

CP001515.PE426       Location/Qualifiers
FT   CDS_pept        527102..528631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0444"
FT                   /product="amino acid transporter"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45824"
FT                   /protein_id="ACS45824.1"
FT                   /translation="MTAATKSQGTPAPNNTGAGGPVTVKRTLSVFDLVVFGMIFMVPIA
FT                   PFSILASVANTSHGMPALAYVIAMVAMLFTAFSFDLMVPRYPSSGSIFVYASDEINGPV
FT                   GFVVGWLMLLQYLITPAVMLIMAGLAIHEYVPAVPVWAWCLIFLAIITVIAMRGAGATV
FT                   MVDKLALVAELIVLLLFFIFGVIYVAKNPSVAHFSFEGFYNPGHFEMGAVMSAVSLCAL
FT                   SFVGFGSVVTLDDQSLDPKHGPSRAMIVIVLILGALYMAMSLLTMCMDPSGKLMAANPN
FT                   NGFYLVAGLAGKWLGVLCAVANALALGIFTSLSGMTAGASLLRVMAKDDALPSVFAKIS
FT                   PKTRVATVATGFVAVLTLALIFIVLPIGMTTGAKISNYGALSTYFMLNIAVIWGLGIKA
FT                   KILEHGKFWRTIIFPLIGAIVTGVIFCSLGGEVLIVGTVWLVLGIIFYYVWTKALHHTP
FT                   DLLSDSRAKGETKAQRIARNAQADAHAKQVAQNVLDQQTAADSMSNESSKA"
     atgaccgctg caacgaagtc acagggaacc ccagctccaa acaatacggg tgcgggcggt        60
     ccggtcaccg tcaagcgcac actctcggta ttcgacctcg tggtgttcgg catgatcttc       120
     atggtgccaa ttgccccgtt ttccattctc gcatcggttg cgaacacgtc gcacggcatg       180
     ccggccctcg catacgtgat cgccatggtc gcgatgctgt tcaccgcgtt ctcgttcgac       240
     ctcatggtgc cccgctaccc gtcgagcggc agcatcttcg tctacgcttc cgatgagatc       300
     aatggcccgg tgggattcgt ggtcggttgg ctcatgctgt tgcagtactt gatcacgccg       360
     gccgtcatgc tcatcatggc cggcctggca attcatgaat acgtgccggc cgttccagtg       420
     tgggcatggt gcctcatctt cctcgccatc atcacggtca tcgcgatgcg tggcgccggc       480
     gccaccgtca tggtggacaa gctcgccttg gtggccgagc tcatcgtgct gctgctgttc       540
     ttcatcttcg gcgttatcta tgtggcgaag aaccccagcg tggcccactt ctccttcgaa       600
     ggcttctaca atccgggcca cttcgagatg ggcgctgtga tgagcgccgt ctcgctgtgc       660
     gcgctgtcgt tcgtcggctt cggctccgtg gtcacgctcg acgatcagag cctcgacccc       720
     aagcatggcc cgtcgcgcgc gatgatcgtg atcgtgctca ttctgggcgc gctctacatg       780
     gcgatgagcc tgctgacgat gtgcatggat ccgagcggca agctcatggc ggccaatccg       840
     aacaacggtt tctacttggt ggccggcctt gccggaaagt ggcttggcgt actgtgcgcc       900
     gtggccaatg cgctcgcgct cggcattttc acctcgctgt cgggcatgac cgccggcgcc       960
     tcgctgctgc gcgtgatggc caaggacgac gcattgccgt cggtcttcgc caagatcagc      1020
     ccgaagaccc gcgtggccac cgtcgccacc ggcttcgtcg ccgtcctcac gctggcgctc      1080
     atcttcattg tgctgcccat cggtatgacc accggcgcga agatctccaa ctacggcgcg      1140
     ctctccacgt acttcatgct caacatcgcc gtcatctggg gcctgggcat caaggcgaaa      1200
     atcctcgaac atggcaagtt ctggcgtacg atcatcttcc cgctcatcgg cgcaatcgtc      1260
     accggcgtca tcttctgctc gctcggcggc gaggtgctca ttgtgggcac cgtgtggctc      1320
     gtgctcggca tcatcttcta ctacgtgtgg acgaaggcgc tacatcacac gccggatctg      1380
     ctctccgact cccgtgccaa gggcgagacc aaggcgcaac gcatcgcccg caatgcacag      1440
     gccgatgccc atgccaagca ggtcgcccag aacgtgctcg accagcagac tgccgcggac      1500
     tccatgtcga acgagtcctc gaaggcctga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page