(data stored in ACNUC30630 zone)

EMBL: CP001515.PE492

CP001515.PE492       Location/Qualifiers
FT   CDS_pept        610747..611805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0515"
FT                   /product="putative binding protein-dependent transporter"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45890"
FT                   /protein_id="ACS45890.1"
FT                   /translation="MTEMNDAVAVGRPVAETKKRGGARKPSNGKGRRNLEIFILSAPAI
FT                   ILFCCFVILPIILGAYYGFYQWKGFGTPAENGKFVGLQNYIVALKDPNFQQAILHTFEI
FT                   VIGSLVIQGPLAILFALLLNQKFKGRGLIRTLIFVPYVVSEVIVGTGWSLLLQKKGAVN
FT                   QILESLGMHGVDWLANPKVAIWTLLLLISWKYIGFAVILMLAGMQSIPEELYEAAKVDG
FT                   AGFWQIQKSITLPLLAPTLRIWVFLSMIGSLQLFDLVYIIWGQYVSTTAGVSTMATYMV
FT                   REGRGAGNYGYGSAVALIIFVISLIVALTYQHFVLNRDLDGALTEKKASKKRKKRQTAE
FT                   DEALAVAMEGVK"
     atgactgaaa tgaatgatgc cgtggcagtc gggcgaccgg ttgccgaaac gaagaagcgg        60
     ggcggagcac gcaaaccctc taacggcaag gggcgcagaa atctcgaaat tttcatcctt       120
     tccgcacccg cgatcatcct cttctgctgc tttgtgatcc ttccgatcat tctgggagct       180
     tactacggtt tctaccaatg gaagggtttc ggcaccccgg ccgagaacgg caagttcgtc       240
     ggactgcaga actacatcgt ggcgttgaag gatccgaact tccagcaggc gattctgcac       300
     acctttgaaa tcgtcattgg gtccctcgtt atccagggcc cgttggccat cctcttcgct       360
     ctcctgctca accagaagtt caaggggcgt ggcctgatcc gtacgctcat cttcgtgccg       420
     tatgtcgttt cagaggtcat cgtcggtacc ggctggagcc tgctgctcca gaagaagggc       480
     gcagtcaacc agatccttga atcacttggc atgcatggtg tcgattggct agccaatccc       540
     aaggtcgcga tctggaccct gctgctgctc atcagctgga aatacatcgg attcgccgtc       600
     atcctcatgc ttgcgggcat gcagtcgatt cctgaggaac tgtacgaagc ggcaaaggtg       660
     gacggtgccg ggttctggca gatccagaag agcatcacat tgccgttgct cgccccgacg       720
     ctgcgcatct gggtcttcct gtcgatgatc ggttcgctgc agctgttcga tttggtctac       780
     atcatctggg gccagtacgt ttccacgacg gccggcgtct ccacgatggc cacctacatg       840
     gtccgtgagg gacgcggtgc aggcaactac ggatatggct ccgccgtcgc cctcatcatt       900
     ttcgtcattt cgctgatcgt ggcgctgacc taccagcact ttgtgctcaa ccgtgatctc       960
     gacggcgcct tgaccgagaa gaaggcgtcc aagaagcgca agaagaggca gaccgcagag      1020
     gatgaggccc tggcggtcgc catggaagga gtgaagtga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page