(data stored in ACNUC30630 zone)

EMBL: CP001515.PE50

CP001515.PE50        Location/Qualifiers
FT   CDS_pept        53714..55240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0052"
FT                   /product="glycoside hydrolase family protein"
FT                   /note="COG5520 O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45448"
FT                   /protein_id="ACS45448.1"
FT                   /translation="MMKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGI
FT                   YPDYTFQMMEGYGCSLTESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDY
FT                   SLSEYQAVEDPLADPELETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKT
FT                   PPEMTRNDASVYGGEEGDVIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPV
FT                   TMLSIQNEAAAATSWDSCLWTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAI
FT                   EHIDEFMSDPEAAKEVGGFAYHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVT
FT                   MLDMTDEQIEALPDGDYKTMVQTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIV
FT                   DRQGGPRHTPGGFAAPIVAEDDGRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEA
FT                   VSARNADGSIGVVLLNQAERDIPVNIRMGGLLVADVPLPARTLSTLVFTE"
     atgatgaagg cgctcaagac cactgtgcac tacgatgtga ccgccgggcg aacccatacc        60
     gagcagacgg agctctcggt catggacgag gcgatgaaca ccgagcacat cgtcgaatcg       120
     aatgtggtgg gaatctaccc ggactacacg ttccagatga tggagggcta tggttgctcg       180
     ctcaccgagt cggcatgcta tctgctctcc aaaatggact ccgcgacgcg caaagaggcc       240
     ttggcccaat ggttcggtcc cgctggaatg gacgcttggt tcgtccgcgt acacatcgac       300
     tcctgtgatt actcgctcag tgagtaccag gccgttgagg atcctctggc cgatcccgaa       360
     ttggagacct tctcgattga ccgtgatcgt cagtacattc ttccggtgct caaagaggcg       420
     atggccatgg cggggcatcc cattcatgtg ttgctctccc catggtcgcc tccggcgcaa       480
     tggaagacgc ccccggagat gacgcggaac gacgcctcgg tgtacggcgg cgaggagggc       540
     gatgtcatcg atctgagcaa gccggggcgc tgtttcggcg gaaggctcaa gccggaatac       600
     tattcgtcgt gggcgcggta cctcgtcaga ttcatcagcg cctatatggc cgaaggtgtt       660
     ccggtgacga tgctgtcgat tcagaacgag gcggctgcgg ccacgagttg ggatagctgc       720
     ctgtggaccg gagatcagga gcgcgaattc ctgaagcacc atctctaccc ggcaatggag       780
     gaggccggtc tgaccgatgc cgtgaagatc ttcatctggg atcataacaa ggaacgtgca       840
     atcgaacaca tcgacgagtt catgagcgac ccggaggcgg cgaaggaggt tggcggtttc       900
     gcttatcact ggtactccgg cgaccatttc gaggcgctgt cgatgttgcg aggcaagtat       960
     cccgacaagg tgctgatgca ttccgaaagc tgtgggctgc atatacccgg caaggtgacc      1020
     atgctcgata tgaccgatga acagatcgag gcgctgcccg atggcgacta caagaccatg      1080
     gtgcagacga ccactccgaa cgagatggac ttcaatgatg cgacggccta tgcccacgac      1140
     atcatcggcg acctgaacca tggaatgcag cggtggatcg actggaacat gatcgtcgac      1200
     aggcagggtg gtccccgtca taccccaggg ggtttcgccg cgccgatcgt cgccgaagac      1260
     gacggacggt atacgctgac catcagctac cggtatattc gcgagattgc acaggccatc      1320
     aaaccgaatg cggtggttct cggcacaagc acgtattcgc gtgatatcga ggcggtctcg      1380
     gcccgcaacg cagatggctc aatcggcgtc gtcctcctta atcaggcgga gcgcgatatc      1440
     ccggtgaaca ttcgcatggg cggcctgctt gtggcggatg tgccgttgcc ggcacgcacc      1500
     ttgagtactc tggtgttcac ggagtga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page