(data stored in ACNUC30630 zone)

EMBL: CP001515.PE501

CP001515.PE501       Location/Qualifiers
FT   CDS_pept        622973..624070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0524"
FT                   /product="peptide chain release factor 1"
FT                   /note="COG0216 Protein chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45899"
FT                   /protein_id="ACS45899.1"
FT                   /translation="MASEEFPAAKTALEEYENIERQMGEQEVWSNPDKMRKLGRRQAQL
FT                   GTIVNAYRTWLNIRNDLDAAQEMAGEDPDFAQEAKRLESELPEAEEKLRTALIPRDPDD
FT                   ARDVIMEIKAGAGGEEAALFAGDLLRMYMRYAEKRGWGVTIQSENSTELGGVKDVQMAI
FT                   RAKGNPSPEEGVWASLKYEGGVHRVQRIPVTESQGRIQTSAAGVIVFPEADEDDDEIEI
FT                   DPKDLKIDIFMSSGPGGQSVNTTYSAVRMTHIPTGIVVSMQDEKSQIQNRAAALRVLKS
FT                   RLLAMKHEQEAAEAADMRHSQVRSLDRSERIRTYNFPENRIVDHRTNYKAYNLDAVLDG
FT                   DLQAVIDSDIQADEEQRLASQQQQQ"
     ttggcaagcg aagagtttcc cgcggcgaag accgcgttgg aggaatacga gaacatcgaa        60
     cgccagatgg gcgagcagga ggtctggtcg aaccccgaca agatgcgcaa gctcggtcgc       120
     aggcaagcgc agctcggcac catagtcaac gcataccgca catggctcaa catcaggaac       180
     gacctcgacg cggcccagga gatggccgga gaggatccgg atttcgcaca ggaagccaag       240
     cgtctggagt ccgagctgcc tgaggcggag gagaagctgc gtacggcgct cattcctcgt       300
     gacccggacg acgcgcgcga tgtgatcatg gagatcaaag ccggcgcggg cggcgaggag       360
     gcggcgttgt tcgccggcga tctgctgcgc atgtacatgc ggtacgcgga gaagcgcggc       420
     tggggtgtga ccatccaaag cgagaactcc accgagctcg gcggcgtgaa agacgtgcag       480
     atggccatcc gcgccaaggg aaacccgtct ccggaagaag gggtgtgggc atcgctcaaa       540
     tacgagggcg gtgtgcatcg cgtgcagcgc atcccggtca ccgagtcgca gggacgcatc       600
     cagacctccg ccgcaggcgt catcgtgttc ccggaggccg acgaagacga cgatgagatc       660
     gagatcgacc cgaaagatct gaagatcgac attttcatga gctccggtcc gggcggccag       720
     tccgtcaaca cgacgtattc ggcagtgcgt atgacgcaca ttcccaccgg catcgttgtg       780
     agcatgcagg acgagaaatc gcagattcag aaccgcgccg ccgcactgcg cgtgctcaag       840
     agccgtctgc tcgcgatgaa gcacgaacag gaggccgccg aagccgccga catgcgccat       900
     tcgcaggtgc gttcgctcga ccgttcggaa agaatccgca cctacaactt cccggagaat       960
     cgcattgtgg atcaccgcac gaactacaag gcgtacaatc tggacgccgt gctcgacggc      1020
     gatctgcagg cggtgatcga cagcgacatc caggctgacg aggagcagcg gctcgcaagt      1080
     cagcagcaac agcaatag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page