(data stored in ACNUC30630 zone)

EMBL: CP001515.PE502

CP001515.PE502       Location/Qualifiers
FT   CDS_pept        624131..625045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0525"
FT                   /product="Methylase of polypeptide chain release factor"
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45900"
FT                   /protein_id="ACS45900.1"
FT                   /translation="MTTDQLIHRCAEYLREAGVDTPEHDVKLIMADVLGCSPSDVESAA
FT                   IMRTDVRALCAKYGRDDDAELVHTFKHMVCRRHAREPLQYIVGHAPFRYLDLKVGPGVF
FT                   IPRQETELIAQDAIEWVTRHGIYSPRIVDLCAGSGALGLALATEIPGAQVWGVELSPQA
FT                   AVWTRRNITQISRTYPDITANYHLEIADATCPITLAHLDGTVDVVVSNPPYVPQSQVPQ
FT                   QPEVRDFDPSLALYGGSSDGMLIPEQIIRRAYALLRPGGLFLMEHDISQPDRTVAFARA
FT                   SGFSDARTGADLTYRPRYLVATK"
     atgaccacag accaactcat tcaccgttgc gccgaatacc tgcgcgaagc cggagtcgac        60
     acccccgagc atgacgtcaa gctgatcatg gcggatgtgc tcggatgctc gccctccgat       120
     gtcgaatcgg ccgcaatcat gcgcaccgac gtgcgtgcgc tgtgtgcgaa gtacggcagg       180
     gacgacgacg cggagctcgt gcacacgttc aagcacatgg tgtgccggcg tcatgcacgc       240
     gaaccgttgc agtacatcgt gggccatgcg ccgttccgct atctcgacct caaggtgggg       300
     cccggggtgt tcattccgcg gcaggagacc gaactgatcg cacaggacgc catcgagtgg       360
     gtgacacggc atggaatcta ttcgccacga atcgtggact tgtgcgcggg cagcggtgcg       420
     ttgggactgg cattggccac cgagattccg ggagcccagg tgtggggcgt ggaactgagc       480
     ccgcaggccg cggtgtggac gcgccgcaat atcacgcaga tctcacgcac ataccccgat       540
     atcaccgcga actaccactt ggagatcgcc gatgccacct gcccgatcac gctcgcgcat       600
     ctcgacggta cggtcgacgt cgtggtgagc aacccgccgt acgtgccgca gtcgcaggtg       660
     ccgcagcagc cggaagtgcg tgatttcgac ccgtcgctcg cgttgtacgg gggatcgtct       720
     gatggcatgc tcattcccga gcagatcatt cggcgtgcct atgcgctgct tcgcccgggt       780
     ggcctgttcc tcatggagca cgacatctcg cagcccgacc gcacagtggc cttcgcgcgc       840
     gccagcggat tcagtgacgc ccgcacgggg gccgatctca cttaccggcc gcgctatctg       900
     gtggcgacca agtag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page