(data stored in ACNUC30630 zone)

EMBL: CP001515.PE509

CP001515.PE509       Location/Qualifiers
FT   CDS_pept        632203..632634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45907"
FT                   /protein_id="ACS45907.1"
FT                   /translation="MKHSAMYIISGIGALVLFVAFLFYTSAPVNLVGWFKLSDLLTIIG
FT                   GLMFIIPFYIVSVRRKMRDNAPNPWAWQYLPVIGMVLMVIGLIFPNGKLTVGVIDLCDV
FT                   LYLFGCVFMLMIFVYPFGSVNEEMLESDVDERVDDDARQ"
     atgaaacact cggcaatgta catcatctca ggaatcggcg cgctcgtgct gttcgtggcg        60
     ttcctgttct acacctctgc accggtgaat ctggtgggct ggttcaaact ctccgatctg       120
     ctcacgatca ttggcggact catgttcatc attccgttct acattgtctc cgtgcggcgc       180
     aaaatgcgcg acaacgcgcc gaatccgtgg gcgtggcagt atctgccggt gatcggcatg       240
     gtgctcatgg tgatcggctt gatcttcccg aatggcaagc tcaccgtcgg tgtgatcgac       300
     ctgtgcgacg tgctgtacct gttcggttgc gtgttcatgc tgatgatctt cgtctacccg       360
     ttcggctcgg tgaacgagga gatgcttgag agcgacgtgg acgaacgcgt tgacgacgac       420
     gcgcgccaat ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page