(data stored in ACNUC30630 zone)

EMBL: CP001515.PE518

CP001515.PE518       Location/Qualifiers
FT   CDS_pept        642920..643051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45916"
FT                   /protein_id="ACS45916.1"
FT                   /translation="MKKQDNTEGRQTRRSYNATRIVAIVVVCAMLVGFAMPLIFAGL"
     gtgaaaaagc aagacaacac cgagggacgc cagacccggc gcagctacaa tgccacgcgc        60
     attgtggcca ttgttgttgt gtgcgcaatg ctggtcggct ttgccatgcc attgatcttc       120
     gccgggcttt ga                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page