(data stored in ACNUC30630 zone)

EMBL: CP001515.PE573

CP001515.PE573       Location/Qualifiers
FT   CDS_pept        706392..707870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0597"
FT                   /product="DNA-repair protein"
FT                   /note="COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45971"
FT                   /protein_id="ACS45971.1"
FT                   /translation="MAVDLKSFYASAECVARGLDPLDANLVVADVSRTSKTICLAVSPA
FT                   LKSFGLGSRARLFEVEERVGVLNEQRRLRAPGHRLAGSSVSAAQLQADPRLGIEYIAAK
FT                   PRMSYYLDTSAKIYGIYLNYASKEDIHVYSVDEVFIDVTKYLKYFGCSAHELARRIVAD
FT                   ILEQTGITATAGIGANLYLAKVAMDIVAKHIPADEDGVRIAELDERRYRELLWSHRPLT
FT                   DFWRVGRGIARKLERQGIMTMGDIARCSLGRAGEYYNEDLLYRFFGVNAETLIDHAWGW
FT                   EPCTIADIKAYTPENSSLSIGQVLARPYPHTQAHTVASEMADCLAQDLAAKGAVTDQVV
FT                   LTVGFDRESLMDGRYLGPVGKDHYGRPVPKSVHGSCDLGRFTSSATAIRQAVVDVFERI
FT                   ADSRLYVRRLTVVAGRVRMLGETQTFEQPSLFEDLEGSQTQQQATADRKELSLQRTVNA
FT                   LRSRFGAASVIKGVNLDEGATGMERSKQIGGHAA"
     ttggcggtgg atctcaaatc gttctatgca tccgccgaat gcgtggcgag gggcctggat        60
     ccgcttgacg ccaatctggt ggtggcggat gtgtcccgta cgtcgaagac catatgcctt       120
     gcggtgtcgc cggcgctgaa atcgttcggg ttggggtcgc gcgccagact gttcgaagtg       180
     gaggagcgtg tcggggtgct caacgagcag cggcgtctgc gtgcgccggg gcacaggctt       240
     gcggggtcgt cggtgagcgc ggcgcaactg caggctgatc cacggctcgg cattgaatat       300
     attgccgcca aaccgcgcat gtcatactat ttggacacca gtgcgaaaat ctacggcatc       360
     tatttgaact acgcctcgaa agaggatatc cacgtgtatt cggtggacga ggtgttcatc       420
     gatgtcacga aatatctcaa gtatttcggg tgctcggccc atgaactggc acgtcgcatc       480
     gtggccgaca ttctcgagca gacgggcatc acggccacgg caggcatcgg cgcgaacctg       540
     tatttggcga aagtggcgat ggatatcgtt gctaagcaca tccccgcgga tgaggacggc       600
     gtgcgcattg ccgaactcga tgaacgcagg tatcgcgaac tgctgtggtc ccaccggcct       660
     ctcaccgatt tctggagggt gggccgtggc atagcccgca aattggagcg gcagggaatc       720
     atgaccatgg gagacattgc acggtgttcg ttgggaaggg ccggcgaata ttacaacgag       780
     gatctgctct acaggttctt cggcgtgaat gcggaaacgc tcatcgacca tgcttggggt       840
     tgggagccat gcacaatcgc cgatattaag gcatatacgc cggagaattc cagcctgagc       900
     ataggtcagg tgcttgcgcg tccctatccg catacacagg cccacaccgt agcgagtgag       960
     atggcggact gcttggcgca ggatctcgct gccaaggggg cggtgacgga ccaggtcgtg      1020
     ctgacagtgg gattcgacag ggagagtctt atggacggcc ggtacctcgg gcccgtaggc      1080
     aaggatcact atgggagacc agtgcccaaa agcgttcatg gctcatgtga tctggggcgg      1140
     ttcacgtcat cggccactgc cattcgacag gcggtggtgg atgttttcga acgcattgcg      1200
     gattcgcggc tgtatgtcag acgcctcacg gttgtagccg gccgggttcg tatgctgggg      1260
     gagacccaga ccttcgagca gccgagtctg ttcgaggatc tggagggctc gcaaacacag      1320
     cagcaggcta cggcagatcg caaggaactg agtctgcagc gcaccgtcaa cgcactgcgc      1380
     agccggttcg gcgcggcatc ggtgatcaaa ggcgtgaacc tcgatgaggg ggcgaccggt      1440
     atggaacgta gcaagcagat cggaggccat gcggcatga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page