(data stored in ACNUC30630 zone)

EMBL: CP001515.PE583

CP001515.PE583       Location/Qualifiers
FT   CDS_pept        714746..715195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45981"
FT                   /protein_id="ACS45981.1"
FT                   /translation="MNKKSLAGPRALTIIGSLAMLVSLVLPYATSSNDTMTAFTIAERW
FT                   KEMQSVANMSVGVSEIILVMIIAIAIFTVLALIFALAAKGIPTLVFVVLAILAYVYFNL
FT                   SFTPYGSYGFGFGVYLFYVAAIAVIAGSIWMIAIKRHNKAAIPNM"
     atgaacaaga aatcattggc aggcccacgc gccctcacga tcattggatc gcttgccatg        60
     ctcgtctcac tcgtactgcc gtacgccacg tcgagcaatg acaccatgac ggcgttcacc       120
     atcgccgaac gatggaagga aatgcagtcg gtcgcgaaca tgagcgtggg tgtttccgaa       180
     atcattctcg tgatgatcat tgccattgca atcttcaccg tgctggcact catcttcgcc       240
     cttgccgcga aaggcattcc gacgcttgtc tttgtcgttc tcgccatact cgcatacgtc       300
     tacttcaacc tgagcttcac accatacggt tcatatggct tcggtttcgg cgtctacctg       360
     ttctatgtgg ccgccattgc agtcatcgcc ggatccatct ggatgatcgc aatcaaacgc       420
     cacaacaaag cagccatccc caacatgtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page