(data stored in ACNUC30630 zone)

EMBL: CP001515.PE584

CP001515.PE584       Location/Qualifiers
FT   CDS_pept        715269..715853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45982"
FT                   /protein_id="ACS45982.1"
FT                   /translation="MRSVNLLPNEGIVAQFDSVRCESPDFKGCESGELTFTTMSLIFSY
FT                   TQVKVFGKDIEHTFLWALHDIKVVDGRPQLIIDKGDAHQCDILLRKGKLELRMDSHADL
FT                   VTLANGINKLITGNDEDIVGAPKTFISGIASMLSDAGKEVTEAFGLRNTANPKSAESKM
FT                   VSRACAGCGAPLHGRQGTSVTCEYCGRSEQL"
     atgcgtagcg tcaatctgct gccaaatgag gggattgttg cgcaattcga cagtgtacgc        60
     tgtgagagtc ctgatttcaa aggatgcgaa tctggagaac tgaccttcac caccatgagt       120
     ctcatcttct cctacaccca ggtcaaggtg tttggcaaag acattgagca caccttcttg       180
     tgggcattgc atgacatcaa agtggtggac ggcaggcccc agctcattat cgacaagggt       240
     gacgcccacc aatgcgacat tctgctccgt aagggaaagc tggaactgcg catggactcg       300
     catgcggatc tggtgacgtt ggcgaacggc atcaacaagc tgatcacggg gaacgatgaa       360
     gacattgtcg gcgcaccgaa aaccttcatc tcgggaatcg ccagcatgct gagcgacgcg       420
     ggcaaggagg tcaccgaagc cttcggcctg agaaacacgg caaatcccaa gagcgccgaa       480
     tcgaaaatgg tctcgcgcgc ctgcgcaggt tgcggtgccc cgctgcacgg gcgccaaggt       540
     accagcgtca cctgtgaata ctgcggtagg tcagagcaac tctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page