(data stored in ACNUC30630 zone)

EMBL: CP001515.PE593

CP001515.PE593       Location/Qualifiers
FT   CDS_pept        727373..727843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0618"
FT                   /product="30S ribosomal protein S7"
FT                   /note="COG0049 Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45991"
FT                   /protein_id="ACS45991.1"
FT                   /translation="MSRKGPSKKHQVLPDPIYGSIVVAQLINKILLDGKKSIAEDIVYS
FT                   ALDMVKDKTDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPARANTLSLRWL
FT                   TDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW"
     atgtcacgta aaggaccttc caagaaacac caggtgcttc cagatccgat ctacggctcg        60
     atcgtggtgg cacagctcat caacaagatc ttgcttgacg gcaagaagtc gatcgcggag       120
     gacatcgtct attccgcact cgatatggtc aaggacaaga ccgatcagga accggttgca       180
     gtgctcaagc gcgctctgga caacatccgt ccgtcgctcg aggtccgctc ccgccgtgtc       240
     ggtggcgcca cctatcaggt gccggtcgag gtcaagcccg ctcgcgcgaa cacgctgtcg       300
     ctgcgctggc tgaccgactt ctcccgcgcc cgtcgcgaga agacgatggc cgagcgtctc       360
     gcaaacgaga tcctcgacgc gtccaacggc cttggcgcat ccgtcaagcg tcgtgaagac       420
     acccacaaga tggcagaggc caacaaggcc ttcgctcatt accgctggta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page