(data stored in ACNUC30630 zone)

EMBL: CP001515.PE60

CP001515.PE60        Location/Qualifiers
FT   CDS_pept        64619..65323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0062"
FT                   /product="ATP binding protein of ABC transporter for
FT                   pentoses"
FT                   /note="COG1129 ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45458"
FT                   /protein_id="ACS45458.1"
FT                   /translation="MHVLAGLEQPDAGSIAVGGETVRLDGVAKAIDLGIAPAFQQPQFC
FT                   ENLDVSANIFLGREMRQGFASRDDEGMYNKAREVLNTLSTSVRAGQSIASLSGGQRQTI
FT                   AIARTLLNDPSLIVLDEPTASLSVTQTAEVLDYIVRLRSDDRSVIMVCHDLPNVFAVAD
FT                   RIVVMRLGEIRAVHNTSETSYEEDIAEIAGVGGSGTTPSRPCERASRARMPIARESHPR
FT                   PSRGGDRDGTMA"
     gtgcatgtgc tggccggtct ggagcagccg gatgccggca gcatcgcggt gggcggggag        60
     acggtgcggc tcgacggcgt ggcgaaggcc atcgacctgg gcatagcgcc ggccttccag       120
     caacctcagt tctgcgagaa tctggatgta tcggcgaaca tcttcctcgg cagggagatg       180
     cggcagggat ttgccagccg cgacgatgag ggcatgtaca acaaggcgcg cgaggtgctt       240
     aacacgctgt cgacgtccgt gcgcgccggc cagagcatcg cgtcgctttc gggaggacag       300
     cgccagacca tcgccatcgc gcgcacgctg ctcaacgatc cgagcctcat cgtgcttgac       360
     gagcccacgg cgtcgctgtc ggtgacgcag acggccgagg tgcttgacta catcgtgcgg       420
     ttgagatcgg acgaccgcag cgtcatcatg gtctgccatg atctgccgaa tgtgttcgcg       480
     gtcgccgatc gcatcgtcgt gatgcggctg ggtgagattc gcgccgtgca caacacgtcg       540
     gagacctcct acgaagagga catcgcggag atcgccggcg tgggcggatc cggtacgacg       600
     ccgtctcggc cgtgcgaacg ggcgtcgcgt gcgcgcatgc cgattgcccg cgagtcgcat       660
     ccgcgcccgt ctcgcggtgg ggatcgcgat ggaaccatgg catga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page