(data stored in ACNUC30630 zone)

EMBL: CP001515.PE611

CP001515.PE611       Location/Qualifiers
FT   CDS_pept        750368..750991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0636"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG0586 Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46009"
FT                   /protein_id="ACS46009.1"
FT                   /translation="MTAWLVSLMEHVGGVGVALAIALESIFPPIPSEIILPLAGFTAAR
FT                   GSMSLFGAILWATMGSLLGAWALYGIARWFGLHRIHKAVDRIPGVSRKDVNKANEWFNK
FT                   YGTWSVLIGRVIPVVRSLISIPAGFNQMNFAKFSGWTFLGSAIWNTVLVTAGYMLGDQW
FT                   CSILGVLNVFEDVIIVVFALMLVFFAWRWVRNLIRERRSTQSHE"
     atgacggcgt ggctcgtctc tctcatggaa catgtgggcg gtgtgggcgt ggcattggcc        60
     atcgccctcg agtcaatctt ccctcccatt cccagcgaga tcattctgcc cctcgccggt       120
     ttcaccgctg cccgtggcag catgagcctg ttcggtgcga tcctatgggc gacaatggga       180
     tcgctgctcg gcgcctgggc gctgtacggc attgcgcgct ggttcggtct ccaccgcatt       240
     cacaaggcag tcgacaggat ccccggcgtg agccgcaagg atgtgaacaa ggcaaacgaa       300
     tggttcaaca agtacggcac ctggtcggtg ctcatcggac gcgtgattcc cgttgttcgc       360
     tcgctcatct cgattccggc cggattcaac cagatgaact tcgcgaagtt ctccggctgg       420
     accttcctcg gctcggcaat ctggaacacg gtgctcgtca ccgccggtta catgctcggc       480
     gaccagtggt gctccattct cggcgtgctc aatgtgttcg aagatgtgat catcgtggtg       540
     tttgcgctga tgctggtgtt ctttgcgtgg cggtgggttc gcaatctgat acgcgaacgt       600
     cgctcgacgc aatcccatga gtag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page