(data stored in ACNUC30630 zone)

EMBL: CP001515.PE671

CP001515.PE671       Location/Qualifiers
FT   CDS_pept        complement(824930..826042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0696"
FT                   /product="hypothetical protein"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46069"
FT                   /protein_id="ACS46069.1"
FT                   /translation="MTDQTQIIETAVIERLSHVIDPELGRSVTDLGMICGVDVRPTGLD
FT                   SFNVRVNVELTVPGCPLSAEISRQIEAAVTSYAEAQLTAEIVVGAMDEEKLKSLVNDLK
FT                   AARRENPFSKPGTKTRIFAIASGKGGVGKSSISANLAATFAALGYDTAAIDADIYGFSL
FT                   PRLFGVHDQPTNLNGMLMPVTAWGVKLMSIGMFAGSDRAILWRGPRLQRSLEQFLADVW
FT                   WGEPDVLILDLAPGTGDMAISVAQALPNAELVVVTTPQPSASDIAVRSGLVALQVPMRV
FT                   RGVVENMSYFEHAGERIDIFGTGGGARVSSQLTDALHYEVPLMAQLPLDPRIREIGESE
FT                   GRPAVLNDDGTLRDDDFGRTFGHLAKSLLA"
     atgactgatc agacgcagat tatcgaaacc gccgtcattg agcggctcag ccacgtgatc        60
     gaccctgagc ttggccgctc ggtcaccgat ctgggtatga tctgcggcgt cgatgttcgc       120
     cccacaggcc tggattcctt caatgtgcgg gtcaatgtgg agctcaccgt gcctggctgc       180
     ccgctgtctg ccgagatcag caggcagatc gaggcggccg tgaccagtta tgccgaggcg       240
     cagctcaccg ccgagatcgt cgtcggcgcg atggatgagg agaaactcaa gtcgctggtg       300
     aacgatctga aagccgcccg tcgtgagaac ccgttcagca aaccgggtac gaaaacgcgc       360
     atcttcgcca tcgcctcagg caagggtggc gtgggaaagt cttccatctc cgccaatctt       420
     gcggccacgt tcgccgcact cggctacgac accgcggcca tcgacgccga tatctacggc       480
     ttctcgctcc cccgcctctt cggcgtccac gaccagccca cgaatctgaa cgggatgctg       540
     atgccggtga ccgcgtgggg cgtcaaactc atgtcgattg gcatgttcgc cggttccgac       600
     cgtgccattc tatggcgagg cccccgtctg cagcgttcgc tcgaacagtt tctggccgat       660
     gtgtggtggg gcgaacccga tgtgctgatt cttgatctcg cccccggcac cggcgacatg       720
     gcgatttcgg tggcgcaggc attgccgaac gccgagctcg ttgtggtcac gaccccacag       780
     ccctccgcgt cggacatcgc cgtgcgttcc ggcctggtcg cacttcaggt gccgatgcgg       840
     gtgcgtggcg tggtggagaa catgagctat ttcgagcatg caggcgaacg gatcgacata       900
     ttcggcacgg gaggcggagc tcgtgtgagt tcccagttga ccgatgcgct gcactatgag       960
     gtgccgctca tggcgcaatt gccgctcgac ccgcgtatcc gtgagatcgg cgaaagcgag      1020
     ggacgtccgg ccgtgctcaa tgatgacggc acgctccgcg acgacgactt cggtcgtacc      1080
     ttcggacatc tggccaagag tcttctggca tag                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page