(data stored in ACNUC30630 zone)

EMBL: CP001515.PE672

CP001515.PE672       Location/Qualifiers
FT   CDS_pept        complement(826173..826781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0697"
FT                   /product="hypothetical protein"
FT                   /note="COG4721 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46070"
FT                   /protein_id="ACS46070.1"
FT                   /translation="MIYPSQASSRKWRVLDITVTSVIAVASGVVFWMWDWVCMAPLTLF
FT                   ENITPGFEGLLNGFWLFAGPLAAVIVRKPGAALYAETVAAFLELTLGNQWGVGGSLIVG
FT                   LMQGLGAELAFALFAYKVWTNLVVLLSGALSGAMCGVYYWFTNPGWGMMRVSIYLGTSV
FT                   VGGVIAAAACIALSRAIARTGALAQFAHWRVRDSEAKRA"
     atgatctacc catcacaagc aagctcgcgc aagtggcgtg ttctcgacat caccgtcacc        60
     tcggtgatcg ccgtcgcatc cggtgtggtg ttctggatgt gggactgggt gtgcatggca       120
     ccactcacat tattcgagaa catcacaccc ggcttcgagg gactgctcaa tggattctgg       180
     ctgttcgcag gtcccttagc cgcggtcatc gtgcgcaagc cgggtgccgc actctatgcc       240
     gaaacggttg cggcgttcct cgagctcacg ctcggcaacc aatggggcgt gggaggctcc       300
     ctcatcgtag gtctgatgca ggggctcggc gccgaactgg ctttcgcgct cttcgcatat       360
     aaggtgtgga ccaatcttgt ggtgctgctg tccggggcat tgtccggagc gatgtgcggc       420
     gtctactact ggttcacgaa cccggggtgg ggaatgatgc gggtctccat ctatttgggt       480
     acctcggtgg tgggcggtgt gatcgcagcc gctgcgtgca tcgcgctgtc gcgtgccatc       540
     gcccgcaccg gagccttggc tcagttcgct cactggcgtg ttcgtgacag tgaggcgaag       600
     cgtgcctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page