(data stored in ACNUC30630 zone)

EMBL: CP001515.PE693

CP001515.PE693       Location/Qualifiers
FT   CDS_pept        849473..850261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46091"
FT                   /protein_id="ACS46091.1"
FT                   /translation="MSEQEQHDTSNGVPNEPNDQHHAAPTAHGERHAINPDAAQDDVRG
FT                   LVLDGRFDDDPPSVGSSNGLEYGALDSQFPATYDPYIYGHPDTDDALGAAAARAQAQRG
FT                   NEYGQPSQQNAYGQQAGLPYQTQNQPGSGRQGNGGRNQPPFNLNDPSFINSMNQMNPDD
FT                   PNQNPLYGHWDPGAIIAFVFALILPLPVLPALFGWFSMRRTKIYHMKGYGLAVAALVIN
FT                   VLYTIMWLYFLVSGVSPTEYLNQMLNTLNNGSGGSDSVKA"
     atgagcgaac aagagcagca tgacacctcc aacggtgttc cgaacgagcc gaacgaccag        60
     catcatgctg ctccgaccgc ccacggcgaa cgccatgcaa tcaatccgga tgccgcacag       120
     gacgatgtga gggggctggt gctcgatggg cgtttcgacg acgacccgcc gagcgtcggt       180
     tcctccaatg gcctggagta cggcgctttg gacagccagt tccctgccac ctatgatccg       240
     tatatctacg ggcatccgga cactgacgat gctttggggg cagccgctgc gcgagcccag       300
     gcccagcggg ggaacgagta tggccagccg tcccaacaga atgcctacgg acagcaggcc       360
     ggactgccgt accagaccca gaaccagccc ggttccggac gtcagggcaa tggaggacga       420
     aaccagccgc cattcaatct gaacgaccca agcttcatca acagcatgaa ccagatgaac       480
     ccggacgacc ccaatcagaa tccgctgtat gggcactggg atccgggcgc catcatcgcg       540
     ttcgtgttcg cgctgattct cccgttaccg gtgctgccgg cgctcttcgg atggttcagc       600
     atgcgtcgca cgaaaatcta ccatatgaaa ggctatggat tggctgtggc ggcgctggtg       660
     atcaacgtgc tctatacgat catgtggctg tacttccttg tctcaggtgt ctcaccaact       720
     gaatatctca accaaatgtt gaatactttg aataatggtt ccggtggatc tgattccgta       780
     aaagcctag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page