(data stored in ACNUC30630 zone)

EMBL: CP001515.PE72

CP001515.PE72        Location/Qualifiers
FT   CDS_pept        81843..82190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45470"
FT                   /protein_id="ACS45470.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYMTTDTDYDELAKELGAHEPGTGSFDP
FT                   FADVENDEFEAQDVDETVDDLDEYAKWAAEAAAKATTGEMPETHAQPKPKPHKPIPMPV
FT                   PETFKHTDQQE"
     atgggccgcg gacgtcagaa agccaaacag cagaagatcg ccaggaagct caagtatatg        60
     accactgaca cggattacga cgagcttgcc aaggaattgg gcgcgcacga gccggggacc       120
     ggctcattcg atccatttgc cgatgtcgag aacgacgaat tcgaggcaca ggacgtcgac       180
     gagacggtgg atgacctcga cgaatacgcg aagtgggccg ccgaagcagc ggcgaaggcc       240
     acgaccggag agatgccgga gactcacgcg caacccaaac caaagccgca caagccgatt       300
     ccgatgccag tgccggaaac cttcaaacac acagaccagc aggagtag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page