(data stored in ACNUC30630 zone)

EMBL: CP001515.PE728

CP001515.PE728       Location/Qualifiers
FT   CDS_pept        888990..890756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0756"
FT                   /product="ComA-like putative transmembrane protein"
FT                   /note="COG0658 Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46126"
FT                   /protein_id="ACS46126.1"
FT                   /translation="MGMRAMTAPACDREHRGIAGSRDLRMLPVAAGVWSATLLTRWVCS
FT                   QHGSGHDVFWQHGRMLQMACLAVASAAIFIALVLIPLTMNGAGKHHGLAVDRAHRMLYT
FT                   LLTVCFAILAATLATAARSLTEHADPVNMSASSSTERVNLTFTAHSLPLATSMGGYDCQ
FT                   VDGNARSIVRHDVRRPSSRGVRVFARQPACGRIAQQGDYAIVGTIQAAAYGEMPIWVLA
FT                   DGDMMAVKEPPAPWRAVHRIRMAFLQTTRGLDNPGVVLVPGVTLGVLGHDAMVHCADGG
FT                   VEDEYAELLQEQCRRAGIMHLMAVSGGHYALVGTLVMGLGARLHWNRFVKAGALAMVYP
FT                   MLTMVLAPSRSVTRAMLMSMLSLGFLMLGRRRQSVHLLCLTVVFGLLLDPSLASSYGFA
FT                   LSCAAVFGLSTACTRMTAWVSHLLPDRLAKLLAASCCAQLFAGPVQILMDNEVSIWSLP
FT                   ANLLVAPFVDAATILGLCSLFVAWMAPGVSRFLAWACSQCTTVIEYAARLFGSEESSTL
FT                   AWMEGIPGAAVLIVTELTTWALIVCIGDLLRAYDDTVTNGDGRPMRMPVRERLTQWFEH
FT                   TLEMMGWLTWRR"
     atgggcatgc gcgcaatgac ggcaccggca tgcgaccggg agcacagggg aatcgcaggc        60
     agccgagacc tgcgcatgct gccggtggct gcgggcgttt ggagcgccac actgctgacc       120
     cgatgggtat gctcccaaca cggatcgggg cacgacgtct tctggcagca tggccgcatg       180
     ctgcaaatgg cgtgcctggc ggtggcatcg gcagccatct tcatcgcact ggtgctcatt       240
     cccctcacga tgaacggggc ggggaaacac catggattgg ccgtggatcg cgcccaccgg       300
     atgctgtaca cactgctaac ggtctgtttc gccatactcg cggccacact tgccacggcg       360
     gcgcgaagcc tgacggagca tgccgacccg gtgaacatgt cggcatcttc ctccacggag       420
     cgtgtgaatc tgacgttcac ggcgcattca ctgccgttgg cgacgtcgat ggggggatac       480
     gactgccagg tcgacggcaa tgcccggtcc atcgttcgcc atgacgttcg acgtccatcg       540
     tcccgcggtg tgcgggtgtt cgcccgacag ccggcctgtg ggcgcatcgc gcagcagggg       600
     gactacgcca tcgtcggaac catccaggcg gcggcatatg gtgagatgcc catatgggtg       660
     cttgcagacg gtgacatgat ggccgtcaag gagccaccgg cgccatggcg tgcggtacat       720
     cggatacgca tggcattcct gcaaacgacc cgcggactcg acaatccggg cgttgtgttg       780
     gttcccggcg tgaccctggg ggtgctcgga cacgatgcga tggtgcactg cgcagatggt       840
     ggagtggagg acgaatacgc cgaactcctg caagagcagt gtcgccgtgc aggcatcatg       900
     catctcatgg ccgtatccgg aggccattac gccctcgtcg gcacattggt gatgggattg       960
     ggggcacggc tccattggaa ccgttttgtg aaggcaggcg cgctcgcaat ggtctacccg      1020
     atgctcacga tggtgcttgc ccccagcagg tcggtcacac gggcgatgct gatgtcgatg      1080
     ctgtctcttg ggttcctgat gttgggccgt cgtcggcaaa gtgtgcatct gctctgcctg      1140
     acggtggtgt tcggattgct gctcgatccg tcattggctt cgagttacgg cttcgcgttg      1200
     tcatgtgcgg cggtgttcgg cttgtcgacg gcatgcacgc gtatgacggc atgggtgtcg      1260
     catctgctac cggaccgttt ggccaagctg ttggcggctt catgctgtgc acagctattc      1320
     gctggtcccg tacagattct catggacaac gaggtgtcaa tatggtcgct gccagcgaat      1380
     ctgctggttg caccattcgt cgatgccgcg acgattctgg ggctgtgctc gttgttcgtc      1440
     gcatggatgg cgccgggcgt ctcacgattc ctggcatggg cgtgctcaca atgcacgacg      1500
     gtcatcgaat atgcggcacg tctgttcggc tcggaggagt cgagcacctt ggcatggatg      1560
     gagggtatac ccggcgctgc ggtgctcatc gtgacggaac tgaccacatg ggcgctgatc      1620
     gtatgcatcg gggacctgct gcgagcctat gacgacacgg tcaccaacgg tgatggccgt      1680
     cccatgcgca tgccggtcag ggaacgcctc acccaatggt tcgaacatac gctcgaaatg      1740
     atggggtggc tgacatggcg cagatga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page