(data stored in ACNUC30630 zone)

EMBL: CP001515.PE731

CP001515.PE731       Location/Qualifiers
FT   CDS_pept        892486..893328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0759"
FT                   /product="hypothetical protein"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46129"
FT                   /protein_id="ACS46129.1"
FT                   /translation="MNTLVIDTSFGSTVGITGHEPICEQDSRTHVEKLQHDIAQVCAEA
FT                   KIQPHDIERIVVGIGPAPFTGLRAGIVAAKAIAYATGAQLLGQDSLSGQAAMMQAAYNG
FT                   DPNLLNTAIFGNWNTPANAGTALHLTLSVNDARRKQLYYTLLANTNADTKDERIQLDMN
FT                   IGTPSNIAAKVSAAVATIQQRHPDQPVAVDIVGHGASKYEQIWSEQPWHGITLDHSLLD
FT                   TGAWGVKTFAALAEHDTEADANPRPIEPLYLRRPDVSVPNPLKHVLNHEGAHRNEANA"
     atgaacacgt tagtcatcga cacatcattc ggatccacag taggcataac cgggcatgaa        60
     ccaatctgcg aacaggattc gcgcacacac gtggaaaaac tgcagcacga cattgcgcaa       120
     gtctgcgcag aggcgaaaat acaaccccac gacatcgaac gcatagtcgt aggaataggc       180
     ccggcaccct tcaccggact acgcgcaggc atcgtggcag ccaaggcaat cgcctatgcc       240
     accggggcac aactcctcgg acaggattcc ctaagcggac aggccgccat gatgcaagcg       300
     gcctacaacg gcgatccgaa cctgctgaac acagccatat tcggcaactg gaatacacca       360
     gccaatgcgg gcaccgcgtt gcacctgacc ctcagcgtca acgacgcgcg ccgcaaacag       420
     ctctactaca ccctgctcgc aaacaccaac gcagacacca aagacgaacg catccaactc       480
     gacatgaaca taggcacgcc atcgaacatc gcggccaaag taagcgcagc ggtcgccacc       540
     atacagcaac gccatcccga ccagccggtc gccgtcgaca tcgtcggaca cggtgcaagc       600
     aaatacgagc aaatctggag cgaacaaccc tggcacggaa tcaccctcga ccattcactc       660
     ctcgacaccg gcgcatgggg ggtgaaaacc ttcgcagcac tcgcagaaca cgataccgaa       720
     gccgacgcca atccacgccc catcgagccc ctctacctgc gcagacccga cgtcagcgtg       780
     cccaacccgc tcaaacatgt gctcaaccac gaaggagcac atcgcaacga ggcaaacgca       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page