(data stored in ACNUC30630 zone)

EMBL: CP001515.PE745

CP001515.PE745       Location/Qualifiers
FT   CDS_pept        906941..907687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0775"
FT                   /product="uridylate kinase"
FT                   /note="COG0528 Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46143"
FT                   /protein_id="ACS46143.1"
FT                   /translation="MALENDLAQPRRVLLKLSGEAFGNGKVGVDTATIRRIAGEIVPAV
FT                   EQGVQVAIVTGGGNFFRGAELQEAGIDRSRGDYMGMLGTVMNCLALQDFLEQAGQATRV
FT                   QTAITMGQVAEPYIPLKAIRHLEKGRVVIFGAGAGMPYFSTDTVSIQRSLEIHCDEVLM
FT                   GKNGVDGVYTADPRKDPSAQRFETLSYKRALIDNLAVMDASAMAMARDNNQTIRVFGLE
FT                   GEGNVTRALMGDSIGTLVSNGDSSLA"
     atggcattgg aaaacgactt ggcacagccg cgccgagtat tgctcaaact ctccggtgag        60
     gcattcggca atggcaaagt cggcgtggac actgcgacca tccgtcgcat cgccggtgaa       120
     atcgttcccg cagtggagca gggagttcag gtggccatcg tcactggcgg cggcaatttc       180
     ttccgcggcg ccgaacttca ggaggcgggc atagaccgtt cccgcggcga ttacatgggg       240
     atgctcggta cggtgatgaa ctgcctggcg ctgcaggatt tcctcgagca ggccggacag       300
     gcgacacgcg tgcagaccgc catcaccatg ggccaggtcg ctgaaccgta cattccgctc       360
     aaggccattc gccatttgga gaaaggtcgt gtggtcatct ttggtgccgg cgcgggcatg       420
     ccgtatttct ccaccgacac cgtgtcgatt caacgttcgc tggagatcca ttgcgatgag       480
     gtcctcatgg gcaagaacgg cgtggacggt gtgtacaccg ccgatcctcg caaggatcca       540
     agtgcccagc gtttcgaaac gttgagctat aagcgcgcgc tcattgacaa tctggccgtc       600
     atggatgcct cggcaatggc catggcccgt gacaacaacc agaccattcg cgtcttcggc       660
     ttggaaggtg aaggtaatgt gacccgcgcg ctgatgggcg attccatcgg tacactggtg       720
     tccaatggag attcctcgct ggcgtag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page