(data stored in ACNUC30630 zone)

EMBL: CP001515.PE76

CP001515.PE76        Location/Qualifiers
FT   CDS_pept        86641..87342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0078"
FT                   /product="rhomboid family membrane protein"
FT                   /note="COG0705 Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45474"
FT                   /protein_id="ACS45474.1"
FT                   /translation="MVTSAIILVCVAVWLLETLFRFVWPAGLAGMLGFGMMQPASMTRE
FT                   PWTLVTAMFLHQPASLWHIGFNMLTLWSVGPVLERLMGHWAFLILYMVSGIGGDAGMMI
FT                   WALLNRSGEGWFTSSYGASGALFGLFAAILVVYRKVGQDLTSMIVWMAINFLMPVIVPN
FT                   IAWQAHVGGFVIGGLFTILMTDGVRALRRRPVLERALIYGAVLLVLLLVVCYACNTANP
FT                   MRTGSWIPFLD"
     gtggtgacct ccgcaatcat tctcgtatgc gtggccgtgt ggctgctgga gaccctgttc        60
     cggttcgtat ggccggcagg gcttgccggc atgctgggct tcggcatgat gcagccggct       120
     tcgatgaccc gcgagccatg gacgctcgtc accgccatgt tcctgcacca accggcgtcg       180
     ctgtggcaca tcggtttcaa catgctcacg ctgtggtcgg tggggccggt gctcgaacgg       240
     ctgatggggc attgggcgtt cctgatcctg tacatggtct cgggcatcgg cggcgatgcg       300
     ggcatgatga tctgggcgct gctcaaccgc tccggcgagg ggtggttcac gtcgagctac       360
     ggcgcctcgg gtgcgctgtt cggcctgttc gccgcgattc tggtggtcta ccgcaaggtc       420
     gggcaagacc tcacttcgat gattgtgtgg atggccatca actttctcat gccggtcatt       480
     gtgccgaaca tcgcgtggca ggcgcatgtg ggaggctttg tgataggcgg tttgttcacg       540
     attctcatga ccgacggcgt gcgcgcattg cggcgtcgcc cggtgctgga acgcgcgctg       600
     atctatggcg cggtgctgct ggtgctgctg ctcgtggtgt gctacgcctg caataccgcg       660
     aatccgatgc gtaccggcag ctggatcccg ttcctcgact ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page