(data stored in ACNUC30630 zone)

EMBL: CP001515.PE765

CP001515.PE765       Location/Qualifiers
FT   CDS_pept        924271..925113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0795"
FT                   /product="hypothetical protein"
FT                   /note="COG3879 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46163"
FT                   /protein_id="ACS46163.1"
FT                   /translation="MPPRRRGKHYDASLRLIDDLVNRPMDALYNDSRLVTKPDSKLTFW
FT                   GTRIIVLIICVAVGFAGCLFVRLLNTDPRKQVRQQLASQLEAQNTHIDELEKQIADMRA
FT                   DVDRQSQSALPSQVEQEVRRNEAAAGATAVEGEGIVLTVADPMVTNSNAQEGSLPREKS
FT                   TNRLRVVTDTDLQLLVSLMWKAGAEAISINDNRLGVQTSIRTAGNSILIGTTPVSSPYR
FT                   IQAIGNKNELANRMGQKELSTLYQEFKDAGMTLQTSKENMIRLKAATPGQVSNAKEIR"
     atgccgcctc ggcgccgggg caaacactac gatgcctcgc ttcggctcat cgacgatcta        60
     gtgaaccgtc cgatggacgc cctctacaac gattcgagac tggttaccaa accggattcg       120
     aaactcacat tctggggcac gcgcattatc gtgctcatca tatgcgtggc cgtcggattc       180
     gcgggatgcc tgttcgtgcg cctgctcaac accgatcccc gcaaacaggt gcgtcaacag       240
     ttggcgtcac agcttgaggc gcagaatact catatcgacg aactggagaa gcagattgcg       300
     gatatgcgcg cagatgtgga ccgccaatcg caatccgcat tgccctccca agtggagcag       360
     gaggtgcggc gcaacgaagc ggctgccggc gccaccgctg tcgaaggcga gggcattgtg       420
     ctcaccgttg ccgacccgat ggtgacgaac agcaatgcgc aggaaggatc gttacctcga       480
     gagaaatcga cgaaccgatt gcgcgtggtc accgacaccg atctgcaatt gctcgtctcg       540
     cttatgtgga aggcaggcgc cgaggcgatc tccatcaacg acaacaggct tggggtgcag       600
     acgtccatac gaaccgcagg caactccata ctcattggca ccacaccggt ttcaagtcca       660
     taccgcattc aagccatagg caataagaac gagcttgcga atagaatggg gcaaaaggag       720
     ctctcgacac tgtaccagga gttcaaggac gccggtatga cgttgcagac cagcaaggag       780
     aatatgattc gactcaaggc ggcaacaccc ggtcaggttt caaatgcgaa ggagatacgg       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page