(data stored in ACNUC30630 zone)

EMBL: CP001515.PE767

CP001515.PE767       Location/Qualifiers
FT   CDS_pept        925448..926326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0797"
FT                   /product="hypothetical protein"
FT                   /note="COG3879 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46165"
FT                   /protein_id="ACS46165.1"
FT                   /translation="MGEANGHENKPIQSAGTPPEPPSGIHVKKILSQQKKDRQNDKLPT
FT                   GAFPAVRKAKPKKQISGRAQSIRARLLASVLVAALCALLSFGYVIQVNNTDMTYETMTE
FT                   SELTRMLGETNTQVQRLEERRTELSRQLTSLQQAADKEAEANRIAKENEESSGILSGRL
FT                   PAEGPGIIVHISAGTKAPIDAATMFNLIEELRNGGAEVIAINDVRVVTSTYISEGANGL
FT                   ICDGKALNAPYIVKAIGEQNNLANAVNMAGGVGSRLTVKFGASVNVETSDDVKITQTQP
FT                   VTNYKYAKIVE"
     atgggcgaag cgaatgggca cgagaacaaa ccgattcagt cagccgggac gcctcctgaa        60
     ccacccagcg gcatccatgt gaagaaaatc ctctctcagc agaaaaaaga ccggcagaat       120
     gacaaactgc caaccggtgc atttccggcg gtcaggaaag cgaaaccgaa gaagcagatt       180
     tccggacgcg cacaatccat tcgcgcgcgg ctgctggcca gtgtacttgt agcggcattg       240
     tgcgcactgc tgtcgttcgg gtacgtgatc caggtgaaca atacggatat gacgtatgag       300
     acgatgaccg agtctgaact cacccgtatg ctcggcgaga cgaacacgca ggtgcagcgc       360
     cttgaagagc gacgcaccga gctcagccgg cagctcactt cactgcaaca ggcagccgat       420
     aaggaggccg aggcgaaccg catcgccaag gagaacgagg agtccagcgg cattctctca       480
     ggtcggcttc ccgcggaggg tcccggtatc atcgtgcata tctccgccgg caccaaggcg       540
     ccgatcgatg cggcgaccat gttcaacctc atcgaggagc tgcgcaacgg aggtgcagag       600
     gtcattgcca tcaacgatgt gcgggtggtc acctccacct acatcagcga aggtgcgaat       660
     ggcctcatat gtgacggcaa ggcactcaac gcgccataca tcgtcaaggc cataggggag       720
     cagaacaacc ttgcgaatgc ggtgaacatg gccggtggcg tcggctcgag gcttacggtg       780
     aaattcgggg cgagtgtgaa cgtcgagacg tccgatgacg tgaaaatcac ccaaacgcag       840
     ccggtgacca actataagta cgcaaagatt gtagaatga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page