(data stored in ACNUC30630 zone)

EMBL: CP001515.PE771

CP001515.PE771       Location/Qualifiers
FT   CDS_pept        927962..928339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0801"
FT                   /product="CrcB protein"
FT                   /note="COG0239 Integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46169"
FT                   /protein_id="ACS46169.1"
FT                   /translation="MIWPNLSAVAVGAFAGGCLRSLASGWLNRKDYAIPCGTLLVNLAG
FT                   SLLVGIMLGVVAMGSVAEPWKALLITGFCGGLTTFSTFTSEVVSLFEEHSTVRAWIYWI
FT                   GSVVAGICCVAFGFLVTRAFA"
     atgatctggc cgaatctaag tgcggtggct gttggcgcat tcgccggcgg ctgtttgcgc        60
     tcattggcct caggctggct taaccgcaag gactacgcaa tcccatgcgg caccctgttg       120
     gtaaatctgg ccggttcgtt gctcgtgggc atcatgctgg gggtagtggc catggggtct       180
     gtggccgagc catggaaagc tttgctgatc acgggattct gcggcggtct gaccacgttc       240
     tccaccttta cgtcggaagt cgtgtcgctg ttcgaagagc acagtacggt tcgcgcgtgg       300
     atctattgga ttggcagcgt cgtggcaggc atttgttgcg tggcgtttgg ttttcttgtc       360
     accagagcgt ttgcgtag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page