(data stored in ACNUC30630 zone)

EMBL: CP001515.PE80

CP001515.PE80        Location/Qualifiers
FT   CDS_pept        91567..92721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0082"
FT                   /product="hypothetical protein"
FT                   /note="COG3764 Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45478"
FT                   /protein_id="ACS45478.1"
FT                   /translation="MKHGGRRGNASARQDGRIDRLPEVGGKRSVMRSVVMILAEILLTV
FT                   GLVCALYVVWMQWWTGVQSENRQIEERQSVGWAQPASDGANAKIAHPQQGDPPLQPEHA
FT                   SIGELIGRVYIPRFGDAWERNLVQGTDLAELNLHGLGHYVDSQMPGQVGNFAIAGHRNG
FT                   YGQPLGDVDKLQPGDAVVVRTKDYWYVYTYTNYTIVTPDETSVISANPEDPSAPPTKRL
FT                   LTMTTCEPKYTAPTHRWISFGEFKYWAKVSDGVPAELAKKGADGATKFISNEQTPFFAK
FT                   LKTLQPVIWGALIAYAIIFIAAAIAWRWPLLRAIREGRRPRPDVDIYGVLVRHQPGPAP
FT                   IRWLLALLLFVAVSLAIIEWACPWAASHIEILREMSNYTAVNTQ"
     atgaaacacg gcggcaggcg tggtaacgca tccgcacggc aggatggacg gattgaccgc        60
     cttccggagg tggggggcaa acggagcgtc atgcggtcgg tggtgatgat cctcgcggag       120
     attctgctca ccgtgggact ggtgtgcgcg ctgtacgtgg tgtggatgca atggtggacg       180
     ggcgtgcagt ccgagaaccg gcagatcgag gaacgccaga gcgtcgggtg ggcgcagccg       240
     gccagcgacg gcgccaatgc gaaaatcgcg cacccgcagc agggcgaccc tccgctgcaa       300
     cccgaacatg cgagcatagg cgagctcatc ggccgcgtgt acatcccgcg cttcggcgat       360
     gcgtgggagc gcaatctcgt gcagggcacc gacctggccg aactcaatct gcacggactc       420
     gggcattacg tggactcgca gatgcccggg caggtgggca acttcgccat tgcggggcat       480
     cgcaacggtt atgggcagcc gctcggcgac gtggacaagc tgcagccagg cgacgccgtc       540
     gtggtgcgca cgaaggacta ctggtatgtg tacacctaca cgaactacac catcgtcacg       600
     ccggacgaga cgtcggtgat ctcggcgaac ccggaggacc cgagcgcgcc gccgaccaag       660
     cgcctgctca cgatgaccac atgcgagccg aaatacaccg cgccgacaca tcgttggatc       720
     agcttcggcg aattcaagta ctgggcgaag gtgagcgacg gcgtgcccgc ggaactcgcc       780
     aaaaagggcg cggatggcgc gacgaagttc atcagcaacg agcagacgcc gttcttcgcg       840
     aaactcaaga cgctgcagcc ggtgatctgg ggggcgctca tcgcgtacgc aatcatcttc       900
     atcgcggcgg cgatcgcctg gcgctggccg ctgctgcgtg cgattcgcga ggggcgccgg       960
     cctcggccgg atgtggacat ctacggcgtg ctcgtgcggc accagcccgg ccccgcgcca      1020
     atccgctggc tgctcgcgct gttgctgttc gtggccgtgt cgctcgcgat catcgaatgg      1080
     gcgtgcccgt gggcggcgag ccatatcgaa atactgcgcg aaatgtcgaa ctacacagcg      1140
     gtgaacacgc agtag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page