(data stored in ACNUC30630 zone)

EMBL: CP001515.PE85

CP001515.PE85        Location/Qualifiers
FT   CDS_pept        complement(98525..100267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0087"
FT                   /product="Bacterial cell division membrane protein"
FT                   /note="COG0772 Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45483"
FT                   /protein_id="ACS45483.1"
FT                   /translation="MAARVRYLLQIIFALLISALGFFQLSERMNGKPTSGSVVMQIVCA
FT                   IMFLVAWGLMSRFQKFGNQSIFACVLMLTSIGILMISRIDGEMDTAVAIRQMMWLCLAL
FT                   VCCYALFAFMKDYRILRRFSYVSMVIGLALLLSPMIPGLGREIGGARIWIGVGSYQLQP
FT                   GEFAKLFLAFFFASYLFNHRDQLAVGGRKVLGLQLPRLRDLGPIVIVWVASMGVLILQH
FT                   DLGTSLMFFAMFVAMLYVATGRASWLIIGFLAFAIGCVAAAHLFAHVGYRVDAWLHPFD
FT                   SEIYNRYPGGSSQIVQGLFGLAAGGLFGTGLGEGHPAITPLANSDFIFASAGEELGLVG
FT                   VFAILMLYLLIIAAGMITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTGLT
FT                   MPYMAAGGSSLIANYILAALLIIISNAANKPQNDLMTDTFRMEAVHALSSRKPRQRKAS
FT                   GNATQVTKPRGNREEEPRPRTSQLPVTSAAVQQSAAVSASPAQDDSATQVVSPQPIVAP
FT                   QQTSEPVSNTRNIPVSPQQATPSAGEETEAMAPLNPSVPPLPQQPHTPTNHQATTSEGG
FT                   AEHE"
     atggccgctc gtgttcgtta ccttctgcag atcatcttcg cactgctcat ctccgcgctc        60
     ggcttcttcc agttgtccga gcgcatgaac ggcaagccca cgtccggcag cgtggtcatg       120
     cagatcgtct gcgcgatcat gttcctagtg gcctggggcc ttatgagccg gttccagaag       180
     tttggcaacc agtcgatctt cgcatgcgtg ctcatgctca catcgatagg tattctcatg       240
     atctcgcgca tcgacggcga gatggacacc gccgtggcca tccgccagat gatgtggctg       300
     tgcctggcgc tcgtctgctg ctacgccctg ttcgccttca tgaaggatta ccgcattctt       360
     cgcagattct cgtatgtgag catggtgatc ggcctcgcgc tgttgctttc gcccatgatt       420
     cccgggcttg gccgtgagat cggcggcgcg cgcatctgga ttggcgtcgg ctcctaccag       480
     ctgcagccgg gcgagttcgc gaagctgttc ctcgcgttct tcttcgcctc gtatctgttc       540
     aaccaccgcg accagctcgc cgtcggcggc aggaaggtgt taggcctgca attgccgcgc       600
     ctgcgcgatc ttggaccgat tgtgatcgtg tgggtcgcct cgatgggcgt gctcattctg       660
     cagcacgatc tgggcacttc gctcatgttc ttcgcgatgt tcgtcgccat gctctacgtg       720
     gccaccggcc gcgcgagctg gctcatcatc ggcttcctcg ccttcgccat aggctgtgtg       780
     gcggccgcgc acctgttcgc gcatgtgggc taccgtgtcg acgcctggtt gcaccccttc       840
     gactccgaga tctacaaccg gtaccccggc ggctcgagcc agattgtgca gggcctgttc       900
     ggtctcgccg ccggcggcct gttcggcacc ggccttggtg aggggcatcc ggccatcacg       960
     ccgctggcca actccgattt catcttcgcg tcggccggtg aggagctcgg tctcgtcggc      1020
     gtattcgcga ttctcatgct gtacctgctc atcatcgcgg ccggcatgat cacggcgatg      1080
     aagatcaaag acggcttcgg caagctgctt gcctcgggac tcgtgttcac gatggcattc      1140
     caggtgttca ccgtggtcgg cggcatcacg ctcgtgattc cgctgactgg tctcacgatg      1200
     ccgtacatgg ctgccggcgg ctcctcgctc atcgccaact acattctggc agccctgctc      1260
     atcatcatct cgaacgccgc gaacaagccg cagaacgacc tgatgaccga cacgttccgc      1320
     atggaggccg tgcacgcgct gagcagccgc aagccgcgcc agcgcaaggc atccggcaat      1380
     gccacgcagg tcacgaaacc gcgcggcaac cgcgaggagg agcctcgccc gcgtacgagc      1440
     cagctgccgg tcacctcggc ggccgtccag caatctgcag ccgtcagtgc gtcaccggca      1500
     caagacgatt cggcaacgca ggtggtctca ccgcaaccga ttgtcgcgcc gcagcagaca      1560
     agcgagccgg tgtccaacac gaggaacatc ccggtgtcgc cgcagcaggc gacgccatcg      1620
     gcaggcgagg agacggaggc catggcaccg ctgaatccga gcgtgccacc gctgccacag      1680
     cagccccata cgccaacgaa ccatcaagca accacaagcg aaggaggtgc cgagcatgaa      1740
     taa                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page