(data stored in ACNUC30630 zone)

EMBL: CP001515.PE87

CP001515.PE87        Location/Qualifiers
FT   CDS_pept        complement(101830..102375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0089"
FT                   /product="hypothetical protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45485"
FT                   /protein_id="ACS45485.1"
FT                   /translation="MITELTFAVLKYAFLILLWLFVWFITRSLYRDVAAFSPRKSRARR
FT                   RKEREVRKSNDALAVSASAQPLPVSAPTPSAAAPSDTAPTPTLLVIIDGPLAGTSVPLN
FT                   SSVITLGRAASNTVVLDDEFVSSHHARVYPDPNTGVWAIEDLHSTNGTVVNQQRISAPT
FT                   ILGPRVPVRIGATTFELR"
     atgattaccg aacttacctt tgcggtactg aaatacgcgt tcctcattct gttatggctg        60
     ttcgtgtggt tcatcacgcg ttcgctgtac cgggatgtcg ccgcgttcag cccacgcaaa       120
     tcccgcgcac gtaggcgcaa ggagcgcgaa gtgcgcaaat cgaacgacgc gttggcggtg       180
     tcagcgtcgg cccagccgtt gcctgtctcc gcacctacac cgtcggcggc cgcgccttcg       240
     gacaccgcac ccacacctac gctgctggtg atcatcgacg gcccgctcgc cggcacctcg       300
     gttccgctga actcctcggt gatcacgctg ggccgcgccg cctcgaacac ggtggtgctc       360
     gacgacgaat tcgtctcgag ccaccatgcg cgcgtgtacc ccgatccgaa caccggagtc       420
     tgggccatcg aagacctgca cagcacgaac ggcaccgtgg tgaaccagca gcgcatctcc       480
     gcacccacca ttctcggccc gcgcgtaccg gtgcgcattg gcgctaccac gttcgaattg       540
     aggtga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page