(data stored in ACNUC30630 zone)

EMBL: CP001515.PE9

CP001515.PE9         Location/Qualifiers
FT   CDS_pept        complement(12745..13539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0009"
FT                   /product="Putative hemolysin III-like membrane protein"
FT                   /note="COG1272 Predicted membrane protein, hemolysin III
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45407"
FT                   /protein_id="ACS45407.1"
FT                   /translation="MKRNNRHIGQVTRSQKPRKVVTAKKLRAQSKRNEQYRTKMQLRQI
FT                   LLEKPKLRGWLHLIAFPFSVATSVILICLAPSGWMKVAISVYSATIILLFGNSAALHLG
FT                   HGYFPKAVDDVLCRIDYSNIFLVIAGTCTPFFFALNNTVICWVYVGVVWVTALLGTFVH
FT                   LIYPVGLDWLFTIVYIVLGLAPITIIWLFWKSPYIGPVPTILVIAGGACYIAGAVCFAL
FT                   RKPNPFPKWFGFHELFHLGTIGGYVCHVIALFMVVLRMRALM"
     atgaagcgca acaaccggca tattggccag gtcacgcgtt ctcagaaacc acgcaaagtg        60
     gtgacggcga agaaactccg cgcgcagagc aagcgcaacg agcagtaccg caccaagatg       120
     cagctcaggc agatccttct ggaaaaaccg aagctgcgcg gatggctgca tctcatcgcc       180
     ttcccgttct ccgtggccac ctcggtgatc ctcatctgcc tggcgccgag cggctggatg       240
     aaggtggcga tcagcgtgta cagcgcgacg atcatcctgc tgttcggcaa cagcgcggcg       300
     ctccacctcg gccacgggta ttttccgaag gccgtcgacg acgtactatg ccgcatcgac       360
     tattcgaaca tcttcctggt gatcgccggc acttgcacgc cgttcttctt cgcactgaac       420
     aacacggtga tctgctgggt gtatgtgggc gtggtctggg tcaccgcatt gcttggcacg       480
     ttcgtgcatc tgatctaccc ggtgggcctc gactggctgt tcaccatcgt ctacattgtg       540
     ctcggactcg ccccgatcac aatcatctgg ctgttctgga aatccccgta catcgggcct       600
     gtgcccacca ttctcgtgat cgccggcgga gcctgctata ttgccggcgc tgtatgcttc       660
     gcgttgcgca agccgaatcc gttcccgaag tggttcgggt tccacgagct cttccatttg       720
     ggtaccattg gcggctatgt gtgccatgtg atcgcactgt tcatggtggt gctgcgcatg       780
     cgcgcgctca tgtaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page