(data stored in ACNUC30630 zone)

EMBL: CP001515.PE94

CP001515.PE94        Location/Qualifiers
FT   CDS_pept        complement(110587..110841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0096"
FT                   /product="hypothetical protein"
FT                   /note="COG2261 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45492"
FT                   /protein_id="ACS45492.1"
FT                   /translation="MHWLWVLIVGAIIGAIAGAITHHSGAMGRISNIIAGLVGSALGEA
FT                   LLGHWGPQLAGMAIIPSLIGAIVVVAVVSFFLMRSSAKN"
     atgcattggt tatgggttct tattgtcgga gcaatcatcg gtgcaatcgc cggcgccatc        60
     acgcatcaca gcggtgcaat gggccggatc agcaacatca tcgccggcct agtgggttct       120
     gcactcggtg aggcgctgtt gggtcactgg ggaccgcagc ttgccggcat ggcgatcatt       180
     ccgtcgttga tcggcgcgat tgtcgtcgtc gcagtggttt ccttcttcct catgaggtct       240
     tcagcaaaga actga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page