(data stored in ACNUC30630 zone)

EMBL: CP001515.PE98

CP001515.PE98        Location/Qualifiers
FT   CDS_pept        complement(116322..118163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0101"
FT                   /product="DO serine protease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45496"
FT                   /protein_id="ACS45496.1"
FT                   /translation="MADDNNNWPTGTPDQNAGSDEHHTDANIGANTEDLNTAPAAPADE
FT                   QPTSVLTPVSGSATEQGEKNDSTSVDGTRKPEPYRLAPQYGAYAPTSQQETTRIPTPPQ
FT                   QGAPNAQQSGLPYQTQNNPQNMPYGVRVDQNQPNAPQGAPNAQNRNPYGVPTGNPFAPS
FT                   NGTPAGPGNPNGPTQSPFGPGSPQQGQPARTPSNIIVAVVAALVAAAICLGVGYAALTN
FT                   GWVKIPTSSSLSSVSSNNHGSGSATVEGGQAPNWASVSANVSKSVVSIQTVVDQGEAKG
FT                   SGAILDKEGHIVTNNHVVSGAKQIQVTLDNGDIYSAKVVGTDSTTDLAVIKLDNPPKDL
FT                   TPITFANSDSLTPGEPIMAIGNPLGYDGTVTTGIVSALNRPVTVMDEENNNAIVTNAVQ
FT                   IDAAINPGNSGGPTFNAAGQVIGINSSIASTASSTQTAGSIGIGFAIPANLVKRVADEI
FT                   IQNGKVEHVALGVTIQSATVEADGVTRGGAVVKSVVANSPAAKAGVKTGDTIVGFNGLA
FT                   VNNNYSLLGFVRAAAMGSTAKLTVVRDGHTMELNVTFDQAEAAVNGSNRNENQNNQNGQ
FT                   NDQNNNGQNDQNNNDGNSDNNNRNRNNDGLIDPFGMW"
     atggctgacg acaacaataa ttggcctacc ggcacgccgg accagaacgc aggctccgac        60
     gagcaccata ccgacgccaa cattggcgcg aacaccgaag atttgaacac ggcacctgcc       120
     gcacctgcag acgaacagcc gacctccgtg ctgacgccgg tttccggttc cgccaccgag       180
     caaggcgaga agaacgactc gacttcggtg gacgggaccc gcaaaccgga accgtaccgc       240
     ctggcaccac aatatggtgc gtacgcgccg acatcccagc aggagacgac gcgcatcccg       300
     acgcccccac agcagggtgc gccgaacgca caacagtccg gactgccgta ccagacacag       360
     aacaatccgc agaacatgcc atatggcgtg cgcgtggacc agaaccagcc gaacgcgcca       420
     cagggtgcac cgaatgcgca gaaccgcaat ccgtacggtg tgccaacggg caatccgttc       480
     gcgcccagca acggcacgcc ggcaggtccg ggcaatccga acggcccgac acagtcgccg       540
     ttcgggccgg gcagcccaca gcaggggcaa ccggcacgca cgccgagcaa catcattgtc       600
     gcggtggtcg cggcactcgt tgcggcggcg atctgcctgg gcgtcggcta tgcggcgctc       660
     accaacggct gggtgaaaat ccccacgtcg agctcgttga gcagcgtctc gtcaaacaac       720
     cacggttccg gctcggccac ggtggaaggc ggtcaggcgc cgaactgggc cagcgtctcc       780
     gcgaacgtgt cgaagtcggt cgtgtcgatc cagaccgttg tggaccaggg cgaagccaag       840
     ggctccggcg cgatcctcga caaagagggc cacatcgtga cgaacaacca cgtggtttcc       900
     ggcgccaagc agattcaggt gacgctcgac aacggcgaca tctacagcgc gaaggtggtg       960
     ggcaccgatt ccacgaccga tctcgccgtg atcaagctcg acaatccgcc gaaagacctg      1020
     acgcccatca cattcgcgaa ttccgacagc ctgacgccag gtgagccgat catggccatc      1080
     ggcaatccgc tcggctacga cggcaccgtg accaccggca tcgtctccgc gctgaaccga      1140
     cccgtcaccg tgatggacga agagaacaac aacgccatcg tcaccaacgc cgtgcagatc      1200
     gacgccgcaa tcaacccggg caactcgggc ggccccacct tcaatgcggc aggtcaggtg      1260
     atcggcatca actcgtcgat cgcctccacc gcctcgagca cccagaccgc cggttccatc      1320
     ggcatcggct tcgcaatccc ggcgaatctg gtgaagcggg tcgccgacga gatcatccag      1380
     aacggcaagg tggagcatgt ggcgctcggc gtcacaatcc agagcgccac ggtagaagcg      1440
     gatggcgtta cgcgcggcgg cgccgtggtc aagtcggtcg tcgcgaacag cccagcagcc      1500
     aaggccggtg tgaagaccgg cgacacgatc gtgggcttca acggcctcgc cgtgaacaac      1560
     aactactcgc tgctcggatt cgtacgtgcc gcagcgatgg ggtccaccgc gaaactcacc      1620
     gtggtgcgag acggtcacac gatggagctc aacgtgacct tcgaccaggc cgaggcggcg      1680
     gtgaacggca gcaaccgcaa cgagaaccag aacaaccaaa acggccagaa cgaccagaac      1740
     aacaacggtc agaacgacca gaacaacaac gacggcaata gcgacaacaa caatcgcaac      1800
     cgcaacaacg acgggctcat cgatccgttc ggcatgtggt aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page