(data stored in ACNUC30630 zone)

EMBL: CP001515.RPMG

CP001515.RPMG        Location/Qualifiers
FT   CDS_pept        446149..446319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="Balac_0363"
FT                   /product="50S ribosomal protein L33"
FT                   /note="COG0267 Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45747"
FT                   /protein_id="ACS45747.1"
FT                   /translation="MASKSADIRPGITLACTVCKERNYITTKNRRNTPDRLELKKFCPK
FT                   CGKQTLHRETR"
     atggcaagca agagcgcaga cattcgtccg ggcatcacgc tggcgtgcac cgtgtgcaag        60
     gagcgtaact acattacgac caagaaccgc cgtaacaccc cggatcgtct cgaactcaag       120
     aagttctgcc cgaagtgcgg caagcagacc ctccaccgcg agacccgctg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page