(data stored in ACNUC30630 zone)

EMBL: CP001515.RPSM

CP001515.RPSM        Location/Qualifiers
FT   CDS_pept        481559..481936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="Balac_0406"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099 Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45789"
FT                   /protein_id="ACS45789.1"
FT                   /translation="MARLAGVDIPNDKRIEVALTYIFGVGRTRAKETLEATGINPDTRV
FT                   KDLTDEQLITLRDYLESNYKIEGDLRREVDADIRRKIQINSYQGMRHRKGLPVRGQRTK
FT                   TNARTRKGPKRTVAGKKKATK"
     atggcacgtc ttgccggagt cgacatccca aatgacaagc gcatcgaggt cgcgctcacc        60
     tatatcttcg gtgtgggacg cacccgcgcc aaggaaaccc ttgaggcgac tggcatcaat       120
     ccagacaccc gcgtcaagga cctgacggat gagcagctga tcacgctgcg tgactacctc       180
     gagtcgaact ataagatcga aggcgatctg cgtcgtgaag tcgacgctga cattcgccgc       240
     aagatccaga tcaacagcta ccagggcatg cgccaccgca agggcctgcc ggtccgcggt       300
     cagcgcacga agaccaacgc acgcacccgc aagggcccga agcgcacggt cgctggcaag       360
     aagaaggcca ccaagtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page