(data stored in ACNUC30630 zone)

EMBL: CP001515.RPSO

CP001515.RPSO        Location/Qualifiers
FT   CDS_pept        399403..399672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="Balac_0322"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG0184 Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45709"
FT                   /protein_id="ACS45709.1"
FT                   /translation="MALTAEEKQDIIAKYATHEGDTGSPEVQIALLTKRIADLTEHLKF
FT                   HKHDHHSRRGLLLMVGDRRRLLDYLKKVDIERYRSLIERLGLRR"
     gtggcactga cggctgaaga aaagcaggac atcatcgcta agtacgctac ccatgagggt        60
     gacacgggct ccccggaggt ccagatcgca ctgctcacca agcgcattgc cgatctcacc       120
     gagcacctga agttccacaa gcacgatcac cactcccgtc gcggtctgct gctcatggtc       180
     ggcgatcgtc gtcgtcttct cgactacctg aagaaggtcg acatcgagcg ttaccgctcc       240
     ctgatcgagc gtctcggcct gcgccgctag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page