(data stored in ACNUC30630 zone)

EMBL: CP001515.SECE

CP001515.SECE        Location/Qualifiers
FT   CDS_pept        377938..378168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="Balac_0308"
FT                   /product="preprotein translocase subunit SecE"
FT                   /note="COG0690 Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45696"
FT                   /protein_id="ACS45696.1"
FT                   /translation="MARKTDHGEEVIKPNVFMRIGLFIKQIIDELRKVVTPTRKQLFYW
FT                   SLAVFIFVALLMVFVTAMDFGLGKLSFLIFG"
     atggcacgca agaccgatca cggtgaggaa gtcatcaagc cgaatgtgtt catgcgcatt        60
     ggcctgttca tcaagcagat tatcgacgaa ctgcgcaagg tggtcacccc gacccgcaag       120
     cagctgttct actggtcgct cgccgtgttc atcttcgtcg cattgctcat ggtgttcgtc       180
     accgcaatgg acttcggact cggcaagctc tcattcctca tcttcggctg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page