(data stored in ACNUC7421 zone)

EMBL: CP001600.PE1

CP001600.PE1         Location/Qualifiers
FT   CDS_pept        60..1451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0001"
FT                   /product="chromosomal replication initiator protein DnaA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67263"
FT                   /db_xref="GOA:C5BHC5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHC5"
FT                   /protein_id="ACR67263.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYINNINGLLNDFCGSDAPVLRFEVGSKPIVPVAVSSAASSGASVPPAAVR
FT                   ASSLARPSWERVTAQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNP
FT                   LFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYY
FT                   RSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSR
FT                   FGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVI
FT                   ANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSV
FT                   ARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI
FT                   RTLSS"
     gtgtcacttt cgctttggca gcagtgtctt gcccgattgc aggatgagtt acctgccaca        60
     gaattcagca tgtggatccg tcctcttcag gcggagctca gtgacaacac gctggcgctg       120
     tatgcgccta accgctttgt tcttgattgg gttcgtgata aatatattaa taatattaat       180
     ggcttgctga atgatttttg cggttccgat gcgccggtgt tgcgttttga ggtgggcagt       240
     aagccgatag tcccggttgc ggtcagcagc gccgccagca gcggcgcgag cgtgccgccg       300
     gccgccgtac gggccagcag tctggcgcga ccgagctggg agcgggttac tgcgcagccg       360
     gagctctcct accgctccaa cgttaatcct aagcacacct tcgataactt tgttgagggt       420
     aagtctaacc agctggcgcg cgcggcggcg cgtcaggtgg cggataatcc gggtggtgcc       480
     tataatccgc tgtttctata cggcggtacc ggcttgggta aaacgcacct gctgcatgcg       540
     gtaggcaacg gcatcatggc gcgtaagcct aatgccaaag tggtatacat gcactctgag       600
     cgttttgttc aggatatggt caaggcgctg cagaataatg ctattgaaga gttcaagcgc       660
     tactaccgct ctgtcgatgc gctgttaata gacgatattc agttttttgc caataaggag       720
     cgctcacagg aggagttttt ccacaccttt aatgcgctgc tggagggcaa tcagcaaatc       780
     atcctgactt ccgatcgcta tcctaaggag atcaatgggg tagaggaccg cttgaagtcg       840
     cgcttcggct ggggactgac ggtggccatt gagccgccgg agctggagac gcgggttgct       900
     attctgatga aaaaagccga tgaaaacgac attcgtctgc cgggcgaagt ggctttcttt       960
     attgccaaac gcctgcgctc gaacgtccgc gagctggagg gggcactgaa ccgggttatc      1020
     gccaacgcca actttaccgg gcgggcgatc accattgatt ttgtacgcga agcgctgcgt      1080
     gatctgctgg cgctgcagga aaagctggtc actatcgaca acatccagaa gacggtggcg      1140
     gagtactata aaattaaagt ggccgacctg ctgtccaagc gccgctcccg ctccgttgcc      1200
     cgcccacgcc agatggcgat ggcgttggcc aaggagctga ccaaccacag tctgccggag      1260
     atcggcgatg cctttggtgg ccgggaccat accacggtgc tgcacgcctg tcgtaagatt      1320
     gagcagctgc gtgaagaaag tcacgatata aaagaagatt tttctaattt aatcagaacg      1380
     ttgtcatcct aa                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page