(data stored in ACNUC7421 zone)

EMBL: CP001600.PE10

CP001600.PE10        Location/Qualifiers
FT   CDS_pept        9631..10098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0010"
FT                   /product="Hsp20/alpha crystallin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67272"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD4"
FT                   /protein_id="ACR67272.1"
FT                   /translation="MRNYDLAPLMRQWIGFDKLANAMQTSLEPQGFPPYNIEKSDDNHY
FT                   RISLALAGFRQSELDLEVEGPRLTVRGNPVKPEKPVEYLHQGLVCKAFELSFTLAEHLT
FT                   VEGAAFENGLLNIDLVRHVPEALQPQRIVISAAPRDPAALECRNEPDTHQQ"
     atgcgtaatt atgatcttgc accgctaatg cgccagtgga ttggttttga caagctggct        60
     aatgccatgc agacctcact ggagccgcag ggatttccac cgtataacat tgaaaaaagt       120
     gatgataacc actaccgcat ctctttggcg ctggccggat ttcgccagag tgagctggat       180
     cttgaggtcg aaggcccacg cctgacagta cgcggtaacc cggtcaagcc ggaaaagcca       240
     gtggagtatc tgcatcaggg gctggtatgc aaagcctttg agttgagttt tacgctggca       300
     gagcacctga cggtagaggg cgctgccttt gagaacggtc tattgaatat cgatctggta       360
     cgtcacgtac cggaggcgct ccagccacag cgtattgtca tcagtgccgc gccgcgcgat       420
     cccgcggcgc ttgaatgtcg gaatgaaccg gatacccatc agcaataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page