(data stored in ACNUC7421 zone)

EMBL: CP001600.PE104

CP001600.PE104       Location/Qualifiers
FT   CDS_pept        complement(108465..108788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0112"
FT                   /product="iron donor protein CyaY, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67367"
FT                   /db_xref="GOA:C5BBD2"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BBD2"
FT                   /protein_id="ACR67367.1"
FT                   /translation="MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFEN
FT                   GSKIVINRQEPLHQIWLATRAGGYHFDYRNGQWRCSRSGVPLPQVLNEACSAQAGIPVT
FT                   LDL"
     atgaatgaca gcgagtttca tctgttggcc gacgggctga tgcaggcgct ggaagaggcg        60
     ctggacgcct gccagagcga tgcggatatt gactgtgaga ccaacggcgg cgtcatgacg       120
     ctgagctttg agaacggcag taaaatcgtg attaatcgac aagaacccct gcaccagatc       180
     tggctggcga cacgcgccgg gggctatcac tttgattacc gtaacggaca atggcgctgc       240
     tcgcgcagcg gcgtgcccct tcctcaggtg ctgaatgagg catgcagcgc acaggccggt       300
     atcccggtaa cgctggatct ctag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page