(data stored in ACNUC7421 zone)

EMBL: CP001600.PE107

CP001600.PE107       Location/Qualifiers
FT   CDS_pept        109989..110693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0115"
FT                   /product="Protein of unknown function, DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67370"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD5"
FT                   /protein_id="ACR67370.1"
FT                   /translation="MSERDSRDRLQPSLADDQVVAYLQQHPDFFIRNARLVEQMMIPHP
FT                   VRGAVSLLEWQLGRQRRQIAVLDQEIEQLITLARDNERLFGSLLALQGHLASAQDVDDF
FT                   LQRLQRWARSLGLSGAYIRLFSDRWRLGAPSRFSHLAIARSDVELLRIQRLGDASHYLG
FT                   SLNGQELLLLLPQARHVGSVALSLMGDFADLGLLVFTSADVQHYQQGMGTALLEQLARL
FT                   IPPMLTRWIERQ"
     atgagcgaga gggatagccg cgaccgtctt cagccgtcgc tggctgatga tcaggttgtg        60
     gcctatttgc agcagcatcc tgatttcttt attcgtaatg cccgcctggt ggagcagatg       120
     atgatcccgc acccggtgcg gggggctgtc tctctgctgg agtggcagct gggccgccag       180
     cgccggcaga ttgctgttct ggatcaggag attgaacagc tcatcacgct ggcgcgagac       240
     aacgagcggc tgttcggcag cctgctggcg ctacagggcc acctggcatc ggcgcaggat       300
     gtggatgact ttctgcagcg cctgcagcgc tgggcccgtt cgttggggct gtccggtgcc       360
     tatatccgtc tgttttccga tcgttggcgc cttggcgcgc cgtcgcgctt ttcccacctg       420
     gcgatcgccc ggtcagacgt agagctgctg cgtattcagc gcctgggcga tgccagccac       480
     tatctgggta gcctgaacgg ccaggagctg ctgctgctgc tgccgcaggc gcgccatgtg       540
     ggatcggtcg ccctctcgct gatgggggat tttgccgatc tggggctgct ggtgtttacc       600
     agcgctgatg tgcagcacta tcagcaggga atgggaacag cgctgctgga gcagctggcg       660
     cggctgatcc cgccgatgct gacccgctgg atcgagcggc aatga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page