(data stored in ACNUC7421 zone)

EMBL: CP001600.PE111

CP001600.PE111       Location/Qualifiers
FT   CDS_pept        114858..115808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0119"
FT                   /product="magnesium and cobalt transport protein CorA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67374"
FT                   /db_xref="GOA:C5BBD9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD9"
FT                   /protein_id="ACR67374.2"
FT                   /translation="MLSAFRLDHGRLSRMELDDTDHLTASLWVDLVEPEEDERQRVQSE
FT                   LGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDAEDHAGNSTVAFTIREGRLFTL
FT                   RERELPAFRLYRMRARNQMLVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIM
FT                   EGQQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPASQLEQAREVLRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELKWSFGYPGAILLMILAGLAPYLYFKRKKWL"
     atgctaagtg catttcgttt agaccacggt cgcttatccc gtatggagct ggatgacacg        60
     gaccatctca ctgcatcgct gtgggtggat ctggtcgagc ccgaagagga tgagcgccag       120
     cgcgtacaga gtgaactggg ccagagtctg gccacccgcc cggagctgga tgatattgag       180
     gcctctgcgc gtttcttcga ggatgaggat ggcctgcata tccactcctt cttctactat       240
     gaagatgcgg aggatcatgc cggaaactcc accgtcgcct ttaccattcg agaagggcgt       300
     ctgtttaccc tgcgtgagcg cgagctgccg gcgtttcgtc tgtaccggat gcgggcgcgc       360
     aatcagatgc tggtggacgg caacgcctat gagctgttgc tggatctgtt tgaaaccaaa       420
     attgagcagc tggctgatga gatcgaaaat atttacagcg atctggagaa gctgagtcgg       480
     gttatcatgg aaggccagca gggggatgaa tatgacgagg cgctgtccac cctggccgag       540
     ctggaggata tcggctggaa ggtccgctta tgtctgatgg atacccagcg tgcgctgaac       600
     ttcctggtac gtaaggcgcg cctgccggca agccagctgg agcaggcccg tgaggttctg       660
     cgcgatatcg aatccctgct gccgcacaat gaatccctgt ttcagaaggt caactttttg       720
     atgcaggcgg cgatgggctt tatcaatatc gagcagaacc gtatcatcaa gatcttctcg       780
     gtggtctctg tggtctttct gccgccgacg ctggtcgcct ccagctatgg gatgaacttt       840
     gaatttatgc cggagctgaa gtggtcgttt ggctatcccg gtgccatcct gctgatgatc       900
     ctggcgggcc ttgcgcccta cctctacttt aagcgtaaaa aatggctctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page