(data stored in ACNUC7421 zone)

EMBL: CP001600.PE113

CP001600.PE113       Location/Qualifiers
FT   CDS_pept        118081..118995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0121"
FT                   /product="phospholipase protein family"
FT                   /EC_number="3.1.1.32"
FT                   /EC_number="3.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67376"
FT                   /db_xref="GOA:C5BBE1"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBE1"
FT                   /protein_id="ACR67376.1"
FT                   /translation="MSDVVMKELKKQRISGRTWMAAGLVLLPLTAQADGESGATQALQH
FT                   NEGVIANMLRHYDNPFTLYPYATNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISL
FT                   AFPIWRGIAGDNSVLGAAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGW
FT                   VLRDIEAGGVHQSNGRADPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPSKDDNPD
FT                   ITKYMGYYEAEMGYRLGESVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYG
FT                   ESLIDYNFRQTRFGVGVMLNDIL"
     atgagtgatg tggtcatgaa agaattaaaa aaacagagga tttccggtcg gacatggatg        60
     gcggccggat tggtactgct gccgttgacg gcacaggcag atggggagtc tggggctacc       120
     caggcattgc agcataacga aggggtgatc gccaatatgt tgcggcatta tgataaccca       180
     tttacgctct atccttacgc caccaactat gtgctgtata cccagaccag cgacatcaat       240
     aaagaggcca tcagctctta cgactggggc gatcaggcta aaaagaatga gattaaattt       300
     cagattagcc tggcatttcc tatctggcgc ggtatcgccg gggataactc ggtgctcggc       360
     gcggcctata cccagcagtc ctggtggcag gcgtttaacc gcagcgaatc ctctccgttt       420
     cgcgaaacta actatgaacc acgcctgttt ttaggctggg cgaccgacta tcccctgttc       480
     ggcggctggg tgctgcgcga tattgaggcg ggtggggtgc accagtccaa tggccgggcg       540
     gatccgacct cgcgcagctg gaaccgtgtc tatacccgct ttctggcgca gaacgggaat       600
     tttcaggttc agctgatgcc gtggtatcgc attcctgaga gtccgagcaa ggacgataac       660
     cccgatatca ccaagtacat gggatactac gaggcagaga tgggttaccg tttgggcgag       720
     agcgtcttca gcctgcgtgg gcgttacaac tggaacagcg gctatggcgc ggctgagctg       780
     ggttggagct atccgctgac ccgccacgtc cgcttctata cccagctgtt cagtggctat       840
     ggcgagtcgt taatcgacta taacttccgc cagacccgct tcggcgtcgg tgtcatgctg       900
     aacgatatcc tgtaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page