(data stored in ACNUC7421 zone)

EMBL: CP001600.PE115

CP001600.PE115       Location/Qualifiers
FT   CDS_pept        121053..121175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67378"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC87"
FT                   /protein_id="ACR67378.1"
FT                   /translation="MASVFALPVMRRGYRHMARWIDRAAVMLLTAARSAPDPEP"
     gtggcgtcgg tatttgcgct gccggtgatg cggcgtggct atcggcacat ggcgcgctgg        60
     atcgaccgcg ctgcggtgat gctgctcacc gcagcgcggt ctgcgcctga tcctgagccg       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page