(data stored in ACNUC7421 zone)

EMBL: CP001600.PE117

CP001600.PE117       Location/Qualifiers
FT   CDS_pept        complement(122599..123129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0125"
FT                   /product="carbohydrate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67380"
FT                   /db_xref="GOA:C5BC89"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC89"
FT                   /protein_id="ACR67380.1"
FT                   /translation="MSESQQQKHVFVLMGVSGSGKSAVANAVAQRLGAAFLDGDFLHPR
FT                   ANISKMADGHALNDDDRTPWLQALNDAVFAMQRTNGVSLIVCSALKKRYRDMLRDGNTN
FT                   LSFIYLQGDFALIESRLLARKGHFFKPQMLVSQFAALEEPTTEERDVFAIDISQPLDNV
FT                   VADTLNTIKSIIA"
     atgagcgaaa gccaacagca aaaacacgtc tttgttctga tgggtgtttc cggcagcggc        60
     aagtccgccg tcgccaacgc cgtcgcccaa cggctgggcg ccgcctttct ggacggtgac       120
     ttcctgcacc cacgcgccaa catcagcaag atggccgacg gccacgcgct gaacgatgac       180
     gatcgcacgc cgtggctcca ggccctcaac gatgcggtct tcgccatgca gcgtaccaac       240
     ggagtctcgc tgatcgtctg ttcggcgctg aaaaagcgtt accgcgacat gctgcgcgat       300
     ggtaacacca acctctcatt catctacctg cagggtgact tcgccctgat cgaaagccgc       360
     ctgttggcgc gcaaagggca cttcttcaaa ccgcagatgc tggtttccca gtttgcggcc       420
     ctggaagagc cgacgaccga agagcgcgac gtgttcgcca tcgacatcag ccagccgctg       480
     gacaacgtag tggccgacac cctgaatacc attaaatcca tcattgccta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page