(data stored in ACNUC7421 zone)

EMBL: CP001600.PE12

CP001600.PE12        Location/Qualifiers
FT   CDS_pept        complement(11620..12339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0013"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67274"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD6"
FT                   /protein_id="ACR67274.1"
FT                   /translation="MTFAVKTWVQRLLMPVMALFFVMQLSGCGDSDKEQQKAFIDYLQN
FT                   TVMRGSVTIPTLSEAQKQQLGHYAGDYALLVTFSQNFNHAMEGSMTPLFNTLQQIRTPQ
FT                   EYLTQRDRLQRELGALNMLGQQIQSAKALADSTYATLKQPEEVKAVFDKAFTKIVTGPS
FT                   NAVMPMIPQAEAVAKTLVQVGDFLQNLGPQVHFDNQGVQLQTQAQVDQYNQLMRDLSVK
FT                   YQALMAAQQQNAGLLQN"
     atgacattcg cagtaaaaac atgggtacag cgtctgctga tgcccgttat ggcactcttt        60
     ttcgtcatgc agctgagtgg ctgcggcgat agcgataaag agcagcaaaa agcctttatc       120
     gactatctgc agaatacggt aatgcgcggc agcgttacga tccccaccct gagcgaggcc       180
     caaaaacagc agctggggca ctatgccggt gactatgctc tcctggttac cttttcacag       240
     aacttcaacc acgccatgga aggcagcatg acgccgctgt tcaataccct gcagcagatc       300
     cgtaccccgc aggagtattt gacccagcga gatcgtctgc agcgggagct tggcgcgctg       360
     aacatgctgg gccagcagat ccagagcgcc aaggctctgg cagacagcac ctatgccacg       420
     ctgaaacagc ctgaggaggt caaagctgta tttgacaagg cctttaccaa gattgtcacc       480
     ggccccagca acgccgttat gccgatgatc ccgcaggcgg aggcggtcgc caaaacgctg       540
     gtacaggtcg gtgatttcct gcaaaacctg gggccgcagg tgcacttcga taatcagggc       600
     gtacagctgc aaacccaggc gcaggtcgat cagtacaacc agctgatgcg cgacctttcg       660
     gtaaaatacc aagcgctgat ggcggcccaa cagcaaaacg ctgggctgct gcagaactaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page