(data stored in ACNUC7421 zone)

EMBL: CP001600.PE120

CP001600.PE120       Location/Qualifiers
FT   CDS_pept        126933..128090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0128"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67383"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC92"
FT                   /protein_id="ACR67383.1"
FT                   /translation="MLHEVTLNYCYTPHPAFISTHFITLNNMNNRALLSCLSGVLMSGV
FT                   AHAATSGNTTELSSTLPSYYGLPQSQAHAVDSVSTAQTPVPEVQKESILPIWGNEARAR
FT                   GYDLPEPFGINVNYMNMRQNIVVDSIGFSGLGWDSYSLPTDLFNIKVGNTRQRSVTQTI
FT                   KLDAWVLPFMNVYSIVGKTRGSSLSKVSVDADPSHYTPGSMDWIIATVVQGMNKSGQLR
FT                   DLDFRLNFKGTTYGAGTVLAGGYGNWFGLVDMNYTQTRFDILDGSIDAFTLSPRVGYRF
FT                   TTPGIDAVGLPDGKLSLWVGSMYQDVQQEFKGTLSDLSMPGGLSALMEIANKQGQGRFD
FT                   VHQHLSSPWNVLIGAQYEITRNFNLTTEVGFAERNSFFISGEYRF"
     atgttgcacg aagttacact caattactgc tatactccgc accctgcttt tatttctact        60
     cactttataa cgcttaataa tatgaataat cgtgcattgc tgtcctgtct ttccggcgtg       120
     ctgatgagcg gtgttgccca tgcggccacg tcgggtaata ccaccgagct cagcagcacc       180
     cttccctcct actacggctt gccccagtcg caggcccatg cggtggacag cgtgtcaact       240
     gcccagacgc cggtgcctga ggtacaaaag gaatcgattc tgccgatttg gggcaatgag       300
     gcgcgtgcgc gcggctacga tttgccagag cctttcggta ttaatgttaa ctatatgaat       360
     atgcgccaga atattgtggt ggatagcatt ggttttagcg ggttgggctg ggacagctat       420
     tcgctgccta cggatctgtt caacattaag gtggggaata cccgtcagcg tagcgtcact       480
     caaacgatta agttggatgc gtgggtgcta cctttcatga acgtctacag tatcgtcggc       540
     aagacgcgcg gcagctcatt gtccaaggtc tctgtcgatg ccgatcccag ccattatacg       600
     ccgggtagta tggattggat catcgccact gtcgttcagg gaatgaataa gagcggacag       660
     ctacgcgatc tggatttccg gctgaacttt aagggcacca cctacggtgc cggtacggtg       720
     ctggccggcg gctacggcaa ctggttcggc ttggtggata tgaactatac ccagacccgc       780
     ttcgatatcc ttgacggcag catcgacgcc tttaccctgt cgccacgcgt cggctaccgc       840
     ttcaccaccc ccggcattga cgccgtcggc ttgccggacg gcaagctcag cctgtgggtc       900
     ggctcgatgt atcaggatgt acagcaggag tttaagggca ctctaagcga tctgtcgatg       960
     ccgggtggat tgtctgcgct gatggagatt gccaataagc agggtcaggg ccgtttcgat      1020
     gtgcaccagc atctgtcgtc gccgtggaac gtgctgatcg gcgcacagta tgagatcacc      1080
     cgtaatttta acctgaccac ggaggtaggc tttgccgagc gcaatagctt ctttatctcc      1140
     ggggagtacc gcttctga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page